A mis dos hermanos, Juan Pablo y Agustín, por su amistad y constante cariño:


Save this PDF as:
 WORD  PNG  TXT  JPG

Tamaño: px
Comenzar la demostración a partir de la página:

Download "A mis dos hermanos, Juan Pablo y Agustín, por su amistad y constante cariño:"

Transcripción

1

2 A mamá por ser mi sostén incondicional, por la alegría heredada, por enseñarme a valorar las pequeñas cosas y hacerme sentir en paz. porque tus palabras son siempre las que necesito escuchar.. A papá por cuidarme y contenerme, por estar atento a todo..por enseñarme con tu ejemplo todos los días..y por inculcarme a ser sobre todas las cosas, una buena persona A mis dos hermanos, Juan Pablo y Agustín, por su amistad y constante cariño: A Juan por enseñarme a que todo es posible y con perseverancia las metas se pueden lograr.. A Agus, porque a pesar de ser el más chiquito, me estás enseñando a cómo afrontar las dificultades que aparecen en nuestro camino y hoy más que nunca me estás dando una lección de vida. A Ángelo por alegrar mis días A Sergio por apoyarme y acompañarme en absolutamente todo lo que hace a mi vida profesional y en lo personal porque me enseñaste a ver las cosas de otra manera..porque con tu ejemplo de vida me enseñás todos los días... Porque gracias a ellos pude hacer posible este camino recorrido. Gracias a los que estuvieron y están..un gracias infinito con el corazón.

3 AGRADECIMIENTOS GRACIAS.. A mi directora de Tesis, María Gabriela Echeverría (Gaby), por haberme brindado la dirección y acercarme a un mundo que era desconocido para mí: el de los virus, a través de su dedicación y consejos, brindándome las herramientas necesarias para transcurrir y concluir esta etapa en mi formación profesional. GRACIAS por todo Gaby!! A mi co-director, Gerardo Marti, porque nunca pensé que desde aquel primer día que nos conocimos en Parasitología General, hace tantos años, terminarías siendo mi director: GRACIAS porque me enseñaste a tomarme las cosas de una manera distinta.porque a través de tu espíritu de trabajo, tu optimismo de todos los días, tu apoyo y continuo estímulo fuiste fundamental en esta etapa de mi vida, no sólo profesional. Al Centro de Estudios Parasitológicos y de Vectores (CEPAVE) y muy especialmente a su directora Dra. Alda González por brindarme el espacio y la infraestructura donde desarrollar esta investigación. Gracias Tita por el apoyo incondicional!! A la Cátedra de Virología de la Facultad de Ciencias Veterinarias (UNLP) y su directora la Dra. Teresa González por haberme permitido la realización de las técnicas virológicas y el uso del moderno equipamiento con que cuenta la cátedra. A la Agencia Nacional de Promoción Científica y Tecnológica (FONCYT) y al Consejo Nacional de Investigaciones Científicas y Técnicas (CONICET), por el otorgamiento de las becas que me permitieron realizar esta tesis doctoral. A la Dra. Silvia Catalá y al Dr. David Gorla, por haber financiado parte de los muestreos en la provincia de La Rioja durante el período de mi tesis (PICT ).

4 AGRADECIMIENTOS Este trabajo de tesis fue financiado parcialmente por la Agencia Nacional de Promoción Científica y Tecnológica (ANPCyT), PICT N y PICT N A los miembros de la RED-TrV CyTED (209RT0364) por haber financiado parte de mi especialización realizada en el exterior. En especial a Diego, por haber confiado en mí. A mí querida casa : La facultad de Ciencias Naturales y Museo (UNLP) que me formó. A los integrantes de la Cátedra de Zoología Invertebrados I. A los integrantes del proyecto de Extensión De qué hablamos cuando hablamos de Chagas? (UNLP), en especial a Mari. y Ceci Al Dr. Patricio Diosque de la Unidad de Epidemiología Molecular, Instituto de Patología Experimental, Facultad de Ciencias de la Salud, Universidad Nacional de Salta, CONICET. Salta, Argentina y a los biólogos Delmi Canale y el Raúl Stariolo del Centro de Referencia de Vectores, Coordinación Nacional de Control de Vectores. Santa María de Punilla, Córdoba, Argentina, por el envío de material. A mis compañeros de viro : Ceci, Marce; Mari, Adri, Vivi, Herchu, Marco, Sabri, Nadin, Javi, Mumi, Verocha, Ale, Fito, Colo, Sole y Ger: por haberme ayudado en absolutamente TODO y haber compartido de diferentes maneras y en distintos momentos mis días en el trabajo. Por los consejos recibidos en diferentes oportunidades. Gracias por la amistad y el cariño brindado. A Ger por tantas veces socorrerme con las figuras, fotos y gráficos de la tesis!!! (Gracias por tanta paciencia!). A Sole, simplemente por haber estado ahí desde el primer día, al pie del cañón!!!!! A Fitachuli: amigo y compañero incondicional..llegar y tomar una mate con vos.y siempre esperarme con una sonrisa!

5 AGRADECIMIENTOS A mis compañeros del CEPAVE: Vic, Gustavo, Evan, Agustín, Pau y Sole, por colaborar de una u otra manera en la realización de esta tesis en un clima de amistad, permanente colaboración y amplia generosidad. A mi querido compañero y amigo Agustín, por ayudarme SIEMPRE cuando te necesité..por las charlas, por los mates, simplemente Gracias!!!!! A toda la gente querida del CEPAVE: a Marcelo, Gastón, especialmente a Enrique y a mi queridísimo Aníbal; por ayudarme con los papeles, impresiones y problemas informáticos, pero por sobre todo por el buen humor de todos los días. A mis compañeros de viajes de campaña: Cailo, Gerardo y muy especialmente a Pini, por haber hecho de esos viajes experiencias sumamente gratificantes que recordaré siempre.porque a pesar del calor y el arduo trabajo todo era motivo de risas!!!! A Cin, Maruja, Nica, Verocha y Meriló por el aguante y momentos compartidos. A Juliana: gracias por el apoyo de este último tiempo!!!!!!! A Roxi, por haberme ayudado con el diseño y armado de las láminas de la tesis, por las ideas..gracias Ro!!!!! A Lore por la revisión minuciosa de la bibliografía. Porque una vez más...estuviste ahí!!!! A Julita, Roxi y Lore: por haberme escuchado y aconsejado. Por tranquilizarme en mis momentos de ansiedad. Gracias Julita por orientarme, gracias Lore por enseñarme con tanto entusiasmo y Ro por el tiempo desinteresado dedicado a mi.gracias por todo el apoyo y amistad brindados. A mis amigos platenses.los que me abrieron las puertas de su casa y su corazón cuando me tenía que quedar en La Plata porque al otro día

6 AGRADECIMIENTOS tenía que venir temprano o cancelaban algún tren Gracias Lore, Julita y Kabe!!!!!!! Gracias por ser tan buenos amigos!! A mis ex compañeros y HOY AMIGOS incondicionales: Chechu, Juli, Ceci C., Lore, Lucas, Mariela, Marce, Julita, Sole, Cailo y Guille por el cariño y amistad desde hace tantos años. A la Dra. Graciela Navone (Gra) por haberme iniciado en este hermoso camino: por haber estado SIEMPRE. Por la palabra justa en el momento preciso. Por ser mí guía no solo en lo profesional, sino también en mi vida personal. Gracias por haber sido esa mamá en los momentos que más te necesite..porque tuviste demasiado que ver en que hoy sea lo que soy y haya llegado hasta acá. Gracias por ese cariño infinito. A Cristina y Andrea por el apoyo en esta última etapa y el cariño brindado. A mis amigos de toda la vida: Nico, Marisya, Elvio, Naty, Pita, Ana, Berni, Lore, Raúl, Vero y Ale.simplemente por ser mis queridos amigos de la vida. A mi amiga del alma Marisya porque estuviste, estás y estarás compartiendo cada momento importante de mi vida. Gracias por el aguante, por ser simplemente la hermana que no tuve. A mis abuelos, hermanos, a Sergio y Ángelo y a papá y mamá, por haberme acompañado y ayudado incondicionalmente en esta etapa. Gracias por tanto amor Muy especialmente quiero agradecer a todas las familias de La Rioja y en especial de la provincia de Chaco, que amable y desinteresadamente ayudaron en la realización de este trabajo.

7 ÍNDICE RESUMEN ABSTRACT CAPÍTULO I 1.1-INTRODUCCIÓN GENERAL TRIPANOSOMIASIS AMERICANA PARÁSITO Y VECTOR VIRUS: CARACTERÍSTICAS GENERALES FAMILIA DICISTROVIRIDAE TRIATOMA VIRUS (TrV): CARACTERÍSTICAS, TRANSMISIÓN Y CONTROL BIOLÓGICO HIPÓTESIS OBJETIVOS GENERALES Y ESPECÍFICOS RELEVANCIA DE LA INVESTIGACIÓN 22 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS DE ARGENTINA 2.1- ANTECEDENTES MATERIALES Y MÉTODOS TRABAJO DE CAMPO COLECTA DE TRIATOMINOS SILVESTRES 25 ÁREAS DE MUESTREO 26 MÉTODOS DE CAPTURA COLECTA DE TRIATOMINOS EN DOMICILIO Y PERIDOMICILIO 34 ÁREAS DE MUESTREO 36 MÉTODOS DE CAPTURA 37 TRIATOMINOS COLECTADOS PREVIAMENTE MANTENIMIENTO EN EL LABORATORIO DE LOS TRIATOMINOS TRABAJO DE LABORATORIO METODOLOGÍA PARA LA IDENTIFICACIÓN Y EXTRACCIÓN DE MATERIA 41 FECAL DE LOS TRIATOMINOS METODOLOGÍA PARA EL ANÁLISIS DE TrV 42 ELABORACIÓN DEL CONTROL POSITIVO 42 DETECCIÓN, AISLAMIENTO E IDENTIFICACIÓN 46 EXTRACCIÓN DE ARN 46 TÉCNICA DE RT- PCR 46 DISEÑO DE PRIMERS 48 PURIFICACIÓN Y CUANTIFICACIÓN 49 SECUENCIACIÓN, ALINEAMIENTO Y ARBOLES FILOGENÉTICOS 53 MICROSCOPÍA ELECTRÓNICA DE TRANSMISIÓN (MET) RESULTADOS TRIATOMINOS SILVESTRES TRIATOMINOS EN DOMICILIO Y PERIDOMICILIO CONTROL POSITIVO DE TrV DETECCIÓN, AISLAMIENTO E IDENTIFICACIÓN 64 TÉCNICA DE RT- PCR 64 PURIFICACIÓN Y CUANTIFICACIÓN 65 iii vii i

8 ÍNDICE SECUENCIACIÓN, ALINEAMIENTO Y ARBOLES FILOGENéTICOS MICROSCOPÍA ELECTRÓNICA DE TRANSMISIÓN (MET) DISCUSIÓN 72 ANEXO TABLAS 75 ANEXO SECUENCIAS 82 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES 3.1-ANTECEDENTES MATERIALES Y MÉTODOS REPLICACIÓN DE TrV EN CÉLULAS DE INSECTO 111 PROCESO DE TRANSFECCIÓN 111 ELECTROPORACIÓN 113 INOCULACIÓN CON TRIPSINA 114 INOCULACIÓN DIRECTA: VIRUS PURIFICADO OBTENCIÓN DE CULTIVO PRIMARIO DE T. INFESTANS LIBRE DE TrV INSTALACION Y MANTENIMIENTO DE COLONIAS DE T. INFESTANS SUSTRATOS PARA LA REALIZACION DE CULTIVO PRIMARIO: 116 EMBRIONES Y ADULTOS INOCULACIÓN DE HUEVOS EMBRIONADOS TÉCNICAS DE CONFIRMACIÓN 119 SDS-PAGE 119 WESTERN BLOT (WB) 120 TÉCNICA DE INMUNOFLUORESCENCIA INDIRECTA (IFI) 121 DETECCIÓN DIRECTA POR RT-PCR 122 MICROSCOPIA ELECTRÓNICA DE TRANSMISIÓN (MET) 122 TÉCNICA DE HEMAGLUTINACIÓN (HA) RESULTADOS REPLICACIÓN TrV EN CÉLULAS DE INSECTO Y CULTIVO PRIMARIO INOCULACIÓN DE HUEVOS EMBRIONADOS TÉCNICAS DE CONFIRMACIÓN DISCUSIÓN 130 CAPÍTULO IV 4.1- CONCLUSIONES FINALES PERSPECTIVAS 135 REFERENCIAS BIBLIOGRÁFICAS 137 ii

9 RESUMEN RESUMEN La Tripanosomiasis americana es el problema sanitario más relevante de la Argentina, afectando cerca de 1,6 millones de personas. La Organización Mundial de la Salud considera a la enfermedad de Chagas como uno de los mayores flagelos de América Latina: unas 18 millones de personas sufren sus consecuencias y 120 millones están en riesgo de infección. Si bien esta enfermedad se distribuye principalmente en América Latina, en las últimas décadas se ha observado con mayor frecuencia en los Estados Unidos, Canadá, muchos países europeos y algunos del Pacífico Occidental. Hasta hoy, el control de esta enfermedad, se basa exclusivamente en insecticidas que acarrean múltiples problemas en cuanto a su incorrecta aplicación y baja selectividad, debido a que eliminan tanto enemigos naturales de los triatominos como otras especies benéficas para el hombre, produciendo un gran deterioro en el medio ambiente, provocando todo esto que los insectos sean cada vez más resistentes a los insecticidas aplicados. La introducción o el incremento de enemigos naturales en poblaciones naturales de las principales especies transmisoras de Chagas, puede lograr con el tiempo la reducción del número de vectores a niveles que aseguren la interrupción de la transmisión del parásito en la población susceptible. Cabe destacar que los aspectos negativos en las campañas de rociado y la perspectiva que esas dificultades se agraven, ha motivado a que la búsqueda de nuevos métodos de control de triatominos de domicilio y peridomicilio haya sido identificada como un área prioritaria de investigación por la Organización Mundial de la Salud. El Triatoma virus (TrV) es el único virus entomopatógeno identificado en triatominos hasta el momento. Existen observaciones que sustentarían el uso de TrV como control biológico. Muscio en 1997, iii

10 RESUMEN registró porcentajes superiores a 90% de mortalidad en el laboratorio en estados ninfales de T. infestans infectados con TrV. Además, Rozas- Dennis y Cazzaniga en el 2000, observaron que la infección con TrV reduce la longevidad y la fecundidad de las hembras adultas, y que las ninfas infectadas muestran parálisis en las patas y dificultad para desprenderse de la exuvia. De acuerdo al Comité Internacional de Taxonomía Viral (ICTV), TrV pertenece a la familia Dicistroviridae cuya especie tipo es el virus de la parálisis del grillo, con un único género: Cripavirus. Es un virus ARN de hebra simple y sentido positivo, con una longitud de bases y una masa molecular teórica de 2.886,4 KDa. La composición de los viriones de TrV es 35% de ARN y 65% de proteínas. El genoma posee dos marcos abiertos de lectura denominados ORF1 y ORF2 que codifican las proteínas no estructurales y de la cápside respectivamente; separados por una región intergénica (IGR). De acuerdo a los estudios realizados hasta el momento, TrV puede transmitirse principalmente por vía horizontal, mediante la ruta fecal-oral, como así también por una vía vertical (transovárica). Su distribución en la naturaleza se restringe solamente a T. infestans y T. sordida. Hasta el momento no se conocen estudios inherentes a la búsqueda de TrV en Latinoamérica: al presente solo se ha encontrado en Argentina. El objetivo central de este trabajo fue, por un lado estudiar la diversidad de TrV en triatominos de nuestro país; y obtener un sistema para la replicación de TrV in vitro. Así, se analizaron triatominos de 10 provincias argentinas desde el 2008 hasta el 2011, resultando un total de 1632 ejemplares pertenecientes a 10 especies de domicilio, peridomicilio y ambiente silvestre: T. infestans, T. guasayana, T. delpontei, T. breyeri, T. eraturysiforme, T. sordida, T. platensis, T. garciabesi, Panstrongylus guentheri y Psammolestes coreodes. Las especies anteriormente mencionadas fueron capturadas en viajes de iv

11 RESUMEN campaña, obtenidas del material conservado en la colección de nuestro laboratorio o enviadas de otros centros de referencia. A todos los insectos se les extrajo la materia fecal para luego extraerle ARN y finalmente analizarlas mediante RT-PCR. Los resultados positivos resultantes de la RT-PCR fueron 29. Estos productos resultantes se purificaron, cuantificaron y se enviaron a secuenciar. El análisis de las muestras secuenciadas no mostraron variabilidad genómica significativa. Esto se vio reflejado tanto a nivel específico, como de hábitat y distribución geográfica de los triatominos. Contar con líneas o cultivos celulares sensibles a la infección con TrV podría traer grandes ventajas. Permitir aislar, caracterizar y estudiar en profundidad la biología del virus nos permitiría obtener masa viral, siendo una herramienta fundamental para su posible uso como agente de control biológico. Si bien, no se conocen líneas celulares susceptibles a TrV, se intentó su replicación en líneas de dípteros y lepidópteros. Se desconoce además, si el virus producirá efecto citopático visible en las células. Con respecto a este otro gran objetivo general, se intentó la replicación de TrV en cultivos celulares. Por un lado, en líneas celulares de insecto, por medio de distintos métodos: transfección, electroporación, inoculación con tripsina y con virus purificado. Por otro lado se intentó obtener cultivo primario de vinchucas sanas. Para esto se utilizaron triatominos de la colonia de nuestro laboratorio. Los sustratos para la realización del cultivo primario fueron embriones y adultos (con y sin tripsina y explantos); además se inocularon huevos embrionados. Para todos los métodos y ensayos descriptos anteriormente, se utilizaron técnicas de SDS-PAGE, Western Blot (WB), Inmunofluorescencia indirecta (IFI) o bien RT-PCR para confirmar la presencia del TrV en las células. Para evaluar el líquido alantoideo se utilizó la técnica de Hemaglutinación (HA). No fue posible la replicación in vitro de TrV en líneas celulares de dípteros (C6/36) y lepidópteros v

12 RESUMEN (SF9, SF21, HighFive). Tampoco fue posible obtener un clon celular partiendo de tejidos adultos o embrionarios de vinchucas sanas. En cuanto a la presencia de virus en líquido alantoideo por HA, en ningún caso se obtuvo resultado positivo, ni tampoco utilizando sobrenadantes supuestamente infectados. Sin embargo el virus TrV purificado utilizado como control, aglutinó los glóbulos rojos de pollo. En las pruebas complementarias de Microscopia electrónica, SDS-PAGE, WB, IFI, RT- PCR tampoco obtuvimos resultados satisfactorios. Este trabajo de tesis, representa uno de los estudios más amplios realizado hasta el presente en TrV de triatominos en Argentina. El registro de este virus es de alta importancia, debido a que de las tres vías posibles de contagio de la enfermedad de Chagas, la vectorial es la predominante en el área endémica, siendo imprescindible profundizar aún más en el conocimiento de los insectos huéspedes para optimizar su control. Los resultados de esta labor, amplían considerablemente la información existente sobre este virus en Argentina, siendo de suma importancia además para el resto de los países afectados por la enfermedad. Si bien no fue posible la replicación del virus in vitro, nada se conocía al respecto sobre TrV. Es por ello que se intentará su replicación en líneas celulares de hemípteros, donde se han citado resultados exitosos en virus muy cercanos filogenéticamente. Se esbozan datos novedosos sobre la distribución geográfica y de ambiente; hospedero y variabilidad genómica de las especies analizadas. Si bien no ha sido uno de los objetivos de este trabajo de tesis, el desarrollo de la misma, permitió ampliar el estudio del virus para poder llegar a utilizarlo en un futuro inmediato, como ya se ha mencionado, como agente de control biológico. Palabras claves: TrV, Triatominae, Enfermedad de Chagas. vi

13 ABSTRACT ABSTRACT The American Trypanosomiasis is the most important health problem in Argentina, affecting about 1.6 million people. The World Health Organization considers Chagas disease as one of the greatest scourges of Latin America: some 18 million people suffer the consequences and 120 million are at risk of infection. Although the disease is mainly distributed in Latin America in recent decades have seen more often in the United States, Canada, many European countries and some Western Pacific. To date, control of this disease is based solely on insecticides that carry multiple problems in their misapplication and low selectivity, because they eliminate both natural enemies of other species of triatomines beneficial to man, causing a major deterioration in the environment, causing all these insects are increasingly resistant to insecticides applied. The introduction or increase of natural enemies in natural populations of key species that transmit Chagas disease, can be achieved over time reducing the number of vectors at levels that ensure the interruption of transmission of infection in susceptible population. Note that the negative aspects of spraying campaigns and the prospect that these difficulties become severe, has motivated the search for new control methods for home and peridomestic triatomines have been identified as a priority area of research by the World Health. Triatoma virus (TrV) is the only entomopathogenic virus identified in triatomines so far. There are observations that would support the use of TrV as a biological control. Muscio in 1997, reported rates over 90% mortality in the laboratory nymphal stages of T. infestans infected with TrV. In addition, Rozas-Dennis & Cazzaniga in 2000, observed that vii

14 ABSTRACT infection with TrV reduces longevity and fecundity of adult females, and infected nymphs show paralysis in the legs and difficulty to get rid of the exuvia. According to the International Committee on Taxonomy Viral (ICTV), TrV Dicistroviridae belongs to the family whose type species is the virus Cricket paralysis, with a single genre: Cripavirus. Is a single strand RNA viruses and positive direction, a length of 9010 bases and a predicted molecular mass of KDa. The composition of virions from TrV RNA is 35% and 65% protein. The genome has two open reading frames called ORF1 and ORF2 encoding nonstructural proteins and capsid respectively, separated by an intergenic region (IGR). According to studies conducted so far, TrV can be transmitted mainly by horizontal transmission through fecal-oral route, as well as a way vertical (transovarial). Its distribution in nature is only restricted to T. infestans and T. sordida. So far no studies inherent in the search for TrV in Latin America: at present only found in Argentina. The main objective of this study was, first study the diversity of TrV in triatomines of our country and get a system for TrV replication in vitro. Thus, triatomines were analyzed from 10 provinces of Argentina from 2008 until 2011, giving a total of 1632 specimens belonging to 10 species of address, the wild and peridomestic T. infestans, T. guasayana, T. delpontei, T. breyeri, T. eraturysiforme, T. sordida, T. platensis, T. garciabesi, Panstrongylus guentheri and Psammolestes coreodes. The above species were captured on the campaign trail, obtained from the material preserved in the collection of our laboratory or sent to other centers. All insects were extracted fecal RNA extract and then finally analyze by RT-PCR. The positive outcomes resulting from the RT-PCR were 29. These resulting products were purified, quantified and were sent to viii

15 ABSTRACT sequencing. The analysis of samples showed no variability sequenced genomic significant. This was reflected both at species, and habitat and geographic distribution of triatomines. Having lines or cell cultures susceptible to infection with TrV could bring great benefits. Allow to isolate, characterize and study in depth the biology of the virus would allow us to obtain mass viral, being a fundamental tool for possible use as biological control agent. Although not known to TrV susceptible cell lines, we attempted replication in lines of Diptera and Lepidoptera. Unknown also occur if the virus cytopathic effect visible in the cells. On this one overriding objective, we attempted TrV replication in cell culture. On one hand, insect cell lines, using different methods: transfection, electroporation, with trypsin and inoculated with purified virus. On the other hand tried to get healthy vinchucas primary culture. For this we used triatomines of the colony of our laboratory. The substrates for the realization of the primary culture were embryos and adult (with or without trypsin and explants) were inoculated in addition embryonated eggs. For all tests described above methods and techniques were used for SDS-PAGE, Western blotting (WB), indirect immunofluorescence (IIF) or RT-PCR to confirm the presence of TrV in cells. To evaluate the allantoic fluid was used the technique of hemagglutination (HA). It was not possible replication in vitro TrV dipteran cell lines (C6/36) and Lepidoptera (SF9, SF21, HighFive). Nor was it possible to clone cellular basis of adult or embryonic tissues of healthy kissing bugs. As for the presence of virus in allantoic fluid by HA, in no case resulted positive, nor suspected to be infected using supernatants. However TrV purified virus used as a control, agglutinated chicken RBCs. Laboratory analyzes of electron microscopy, SDS-PAGE, WB, IFA, RT-PCR ix

16 ABSTRACT also obtained satisfactory results. This thesis represents the largest study done so far in TrV of triatomines in Argentina and around the world. The recording of this virus is of high importance because of the three possible routes of transmission of Chagas disease, the vector is predominant in the endemic area, being essential to further deepen the knowledge of insect hosts to optimize their control. The results of this work, significantly expand existing information on this virus in Argentina, besides being of great importance for the rest of the countries affected by the disease. If it was not possible virus replication in vitro, nothing was known about it on TrV. That is why we will attempt replication in cell lines of Hemiptera, where successful results have been cited in virus phylogenetically very close. It outlines novel data on the geographic and environment, host and genomic variability of the species analyzed. While there has been one of the objectives of this thesis, the development of it, broadened the study of viruses in order to get to use in the immediate future, as already mentioned, such as biological control agent. Keywords: TrV, Triatominae, Chagas' disease. x

17 CAPÍTULO I: INTRODUCCIÓN GENERAL CAPÍTULO I 1.1-INTRODUCCIÓN GENERAL TRIPANOSOMIASIS AMERICANA La Organización Mundial de la Salud considera a la enfermedad de Chagas como uno de los mayores flagelos de América Latina, estimando que 18 millones de personas sufren sus consecuencias y 120 millones están en riesgo de infección (WHO, 2005; OPS, 2006). El Chagas es el problema sanitario más relevante de la Argentina que afecta a 1,6 millones de personas. Esta enfermedad se la conoce además como Tripanosomiasis americana y lleva el nombre del médico brasileño Carlos Chagas quien la descubrió en Es una infección parasitaria hemática e hística causada por un protozoo flagelado: el Trypanosoma cruzi. Este parásito es hematófago, se reproduce en los tejidos por división binaria, múltiple y progresiva, pasando por una forma denominada amastigote (no flagelada) que se ubica en los tejidos, especialmente en miocardio, donde luego de un largo período evolutivo, produce lesiones cardíacas irreversibles en aproximadamente un 15 a 40 % de los individuos afectados (Storino y Milei, 1994; Lorca, 2001; Gascon et al., 2007; Rassi et al., 2010). Se estima que es una de las principales causas de muerte por enfermedades parasitarias (Peck, 2009) y según los datos de la Organización Mundial de la Salud, en el 2008 esta enfermedad causó la muerte a más de personas (WHO, 2010). Si bien la enfermedad de Chagas se distribuye principalmente en América Latina, en las últimas décadas se ha observado con mayor frecuencia en los Estados Unidos, Canadá, muchos países europeos y algunos del Pacífico Occidental. Esto obedece sobre todo a la movilidad de la población entre América Latina y el resto del mundo. Su distribución geográfica se extiende desde el paralelo 40 de latitud norte (en el sur de Estados Unidos en América del Norte), al paralelo 45 de latitud sur de Argentina y Chile (Hayes y Schofield, 1990). El proceso de urbanización en América Latina, intensificado en la segunda mitad del siglo XX, ha modificado el perfil epidemiológico de esta enfermedad, y los movimientos migratorios desde los países endémicos han posibilitado que la enfermedad de Chagas sea diagnosticada en zonas 1

18 CAPÍTULO I: INTRODUCCIÓN GENERAL donde la infección no es endémica (Sztajzel et al., 1996; Ueno, 1995). España se ha convertido en uno de los países europeos que recibe más inmigrantes procedentes de América Latina. La última reunión de la OPS (2006) en Montevideo se hizo eco de esta realidad, y en su informe final hace alusión a las necesidades que tienen los países receptores de inmigrantes originarios de áreas endémicas para hacer frente a la enfermedad de Chagas y poder atender adecuadamente a las personas afectadas, así como para evitar la transmisión de T. cruzi por las vías vertical y sanguínea (Baruch et al., 2005) (Fig.1a). Figura 1a: Distribución de casos de infección por T. cruzi basado en estimaciones oficiales y el estado de la transmisión del vector a nivel mundial. Fuente: World Health Organization (2010). La infección es propagada principalmente por vía vectorial. Se transmite a los seres humanos principalmente por las heces de insectos hemípteros hematófagos de la familia de los triatominos, conocidos vulgarmente en Argentina como vinchucas (de origen quechua, que se deja caer ), siendo el más importante en nuestro país Triatoma infestans. 2

19 CAPÍTULO I: INTRODUCCIÓN GENERAL El modo de infestación es por medio de las deyecciones contaminantes de los insectos, que penetran por las escoriaciones de la piel, producidas por el rascado, luego del escozor que causa la picadura de la vinchuca. Los mamíferos son susceptibles al parásito, mientras que las aves son refractarias a T. cruzi (Storino, 2010). Además de la transmisión vectorial como una de las principales, el parásito se transmite entre otras por vía connatal, transfusional y transplante de órganos (Storino, 2002) así como accidentes de laboratorios e ingesta del parásito (Brener, 1984; Rodriguez Coura et al., 2007; Valente et al., 1999; Hofflin et al., 1987). En el hombre, la enfermedad cursa tres periodos evolutivos (Dias, 1995). Muchos autores proponen que en la gran mayoría de los casos, después de un período de incubación, se instala la fase aguda de la enfermedad, luego una fase crónica que puede permanecer indeterminada o evolucionar hacia las formas crónicas definidas, cardíacas y/o digestiva, afectando sobre todo al esófago y/o colon (Carlier et al., 2002; Prata, 2001). -Período primario o agudo: etapa donde se produce la diseminación polihística del parásito, caracterizada por un síndrome febril-infeccioso generalizado, pudiendo dar origen a una miocarditis aguda y/o meningoencefalitis aguda. Dura entre 20 a 30 días y suele pasar desapercibida por falta de síntomas, aunque pueden presentarse síntomas inespecíficos (fiebre, malestar general, cefaleas, hepatomegalia y esplenomegalia), se la suele confundir con otras enfermedades, dificultando el diagnóstico. En algunos casos puede llegar a ser muy grave (formas cardiológicas y/o neurológicas), sobre todo en niños y recién nacidos de bajo peso, que de no ser tratados precozmente, mueren en poco tiempo. -Período secundario intermedio, inaparente, latente o crónico indeterminado: caracterizado por la disminución de la parasitemia, atenuación e incluso desaparición de los síntomas. La mayoría de las veces pasa inadvertida. Este período puede durar 30 años, calculándose que entre el 15 y el 40 % o entre el 20 y el 30 % de los pacientes (de acuerdo a los diferentes autores) desarrollarán la etapa crónica siguiente, con lesiones irreversibles. El resto, permanecerá en forma crónica indeterminada o latente durante toda la vida. -Período terciario o crónico determinado: por último esta fase produce lesiones en el corazón, sistemas digestivo, nervioso central y periférico, generalmente 3

20 CAPÍTULO I: INTRODUCCIÓN GENERAL irreversibles: miocardiopatía dilatada, síndrome de disperistalsis esófagogastro-entérico, disautonomía y pocas veces, neuropsicopatía. Estos cuadros podrán presentarse en forma aislada o asociada. Otra particularidad de esta etapa es la larga evolución de las lesiones, pudiéndose manifestar alteraciones crónicas luego de 15 a 30 años de la primoinfección (Storino y Milei, 1986). Cabe destacar que el Ministerio de Salud de la Nación resalta en su guía para el tratamiento de pacientes con Chagas, que esta enfermedad evoluciona en dos fases; aguda y crónica; cada una de ellas con características clínicas, criterios diagnósticos y terapéuticos diferentes, mencionados anteriormente (Min. Salud de la Nación, 2006). Las formas o vías de infección son: a) Vía entomológica: es la transmisión indirecta, ya que las formas infectantes entran al hombre a través de soluciones de continuidad o de las mucosas, vehiculizadas por las deyecciones de los vectores. b) Vía transfusional: en este caso, la sangre del dador es incorporada en forma directa al torrente circulatorio del receptor sano. c) Vía transplacentaria o congénita: la madre infectada con T. cruzi puede en determinadas condiciones, infectar al hijo durante la gestación o en el momento del parto. d) Vía oral: alimentos contaminados por deyecciones de vectores infectados con T. cruzi. e) Otras vías: los accidentes de laboratorio, por el mal manejo de pipetas con cultivo de T. cruzi; la manipulación de animales infectados, sean de laboratorio o silvestres, puede producir la infección del hombre a través de las escoriaciones o pequeñas soluciones de continuidad en las manos (Carcavallo, 1985; Rodriguez Coura et al., 2007). Si bien la vía vectorial en America Latina es una de las principales vías de transmisión, la infección tripanosómica depende de la convergencia, en determinado tiempo y lugar, del agente etiológico, del insecto vector, del hospedero animal o humano y del individuo susceptible, todo dentro de un contexto geográfico favorable y de un conjunto de factores sociales, económicos y culturales. Este conjunto de factores debe permitir en forma óptima la nidificación, alimentación y reproducción de los vectores y de los reservorios y la convivencia de los mismos, generalmente tolerada por 4

21 CAPÍTULO I: INTRODUCCIÓN GENERAL falencias educativas, con la comunidad humana. Este conjunto de circunstancias son definidos como factores de probabilidad de infección (Rabinovich, 1973) PARÁSITO Y VECTOR En 1911, Carlos Chagas describió una nueva enfermedad provocada por un protozooario flagelado, el T. cruzi. Así, por primera vez en la historia, Chagas reconoció una enfermedad parasitaria como una entidad clínica, identificando su agente etiológico así como al insecto vector (Chagas, 1911). El agente etiológico de la enfermedad, el T. cruzi es un protozoo flagelado, que pertenece a la súper clase Mastigophora, orden Kinetoplastida, familia Tripanosomatidae, genero Trypanosoma, subgénero Schyzotripanum, sección Stercoraria (Fig. 1b). Estos parásitos, están caracterizados por tener un tamaño de 12 a 20 µm, el cuerpo alargado de extremo posterior corto y puntiagudo, un solo flagelo y una sola mitocondria. Una red compacta y compleja denominada kinetoplasto se sitúa en el extremo posterior del cuerpo (Cortez et al., 2007). Es un parásito intracelular con un ciclo de vida que involucra vertebrados e invertebrados. Asume diferentes tipos morfológicos y funcionales que se alternan entre un hospedador y el otro y en formas replicativas, con una multiplicación extracelular como epimastigotes en el insecto y multiplicación intracelular como amastigotes en el hospedero vertebrado. En cuanto a las formas infectivas se encuentran: tripomastigotes metacíclicos en el insecto y tripomastigotes sanguíneos en la corriente circulatoria del vertebrado (Garcia y Azambuja, 1991; Hoare y Wallace, 1966; Pessoa y Martins, 1977). Los reservorios naturales del parásito son, además del propio hombre, los animales silvestres: primates, roedores, marsupiales, entre otros. 5

22 CAPÍTULO I: INTRODUCCIÓN GENERAL Figura 1b: T. cruzi, parásito de la enfermedad de Chagas. Los vectores son las llamadas vulgarmente vinchucas, que albergan el parásito que causa esta patología. Pertenecen al Orden Hemíptera, Infraorden Cimicomorpha, Superfamilia Reduvioidea, Familia Reduviidae, Subfamilia Triatominae (Grimaldi y Engel, 2005). En nuestro país, T. infestans es el principal vector de T. cruzi (Segura et al., 1999). T. infestans es de hábitos antropófilos y actividad nocturna, se trata de un insecto que desde el punto de vista ontogénico, posee tres fases: huevo, cinco estadios inmaduros llamados ninfas y adulto (Fig. 1c). Junto con Rhodnius prolixus, T. infestans es una de las especies de mayor importancia en la transmisión de T. cruzi en América (Lauricella, 2005) (Fig. 1d). Figura 1c: Metamorfosis incompleta de triatominos. Fuente: Marti y Sanmartino (2008). 6

23 CAPÍTULO I: INTRODUCCIÓN GENERAL Su alimentación es exclusivamente hematófaga, de carácter discontinuo y funciona como agente regulador de los procesos metabólicos. En cada estadio, después de que se ha alimentado y en dependencia del estado de desarrollo del insecto, temperatura del ambiente y fuente de alimento, ocurre la sustitución del exoesqueleto viejo por el nuevo: proceso denominado muda o ecdisis, permitiendo de esta manera el crecimiento corporal del triatomino. La última muda culmina con la metamorfosis, cuando las ninfas sufren transformaciones morfológicas incompletas y adquieren las características del adulto: insectos hemimetábolos (Lent, 1948; Buxton, 1930; Wiggelesworth, 1972; Azambuja y Garcia, 1997). Figura 1d: T. infestans (Klug): principal vector de la enfermedad en nuestro país (vista dorsal). El ciclo de T. cruzi se desarrolla en el hombre y en el triatomino (Fig. 1e): se inicia cuando un insecto hematófago infectado pica a un ser humano y defeca. Los tripomastigotes metacíclicos se transmiten en las heces. Entran en el huésped a través de la herida o por el cruce de las membranas mucosas. Los T. cruzi se diseminan por el torrente sanguíneo alcanzando distintos órganos, preferentemente corazón, músculos, sistema nervioso, aparato 7

24 CAPÍTULO I: INTRODUCCIÓN GENERAL digestivo y sistema reticuloendotelial. En estos tejidos, se reproducen por fisión binaria, se multiplican rápidamente y pasando luego de una forma flagelada a una no flagelada, denominada amastigotes (de Lana y Tafuri, 2005). Después de la reproducción, una gran cantidad de amastigotes se encuentran en la célula infectada, formándose verdaderos nidos o seudoquistes que producen complejos fenómenos inmunopatológicos y reacción inflamatoria que participarán en la patogenia de las lesiones y prolongarán la enfermedad (Storino et al; 2003). Luego de aproximadamente diez duplicaciones, el amastigote se convierte en tripomastigote y la célula se rompe, generando de esta manera que queden en circulación. De este modo, invaden otras células del organismo hospedador. El tripomastigote vuelve a infectar otra célula repitiéndose el ciclo de multiplicación. Esto genera una parasitemia persistente en el vector que al absorber sangre, reiniciará la transmisión de la enfermedad. Si bien, el número de parásitos circulantes se verá limitado por la respuesta inmune del huésped, esta será incapaz de erradicarlo (Storino y Milei, 1986). El ciclo de T. cruzi prosigue cuando un triatomino, libre de infección se contamina al alimentarse del mamífero o del hombre parasitado. Los parásitos circulantes ingeridos se transforman en esferomastigotes en el estómago del insecto del vector, y son los responsables de la persistencia de la infección en el insecto. Luego los esferomastigotes se diferenciarán a epimastigotes, que se multiplicarán en su progresión por el tubo digestivo hacia la ampolla rectal y es ahí donde se diferenciarán en tripanosomas metacíclicos. El triatomino parasitado cuando vuelva a alimentarse, eliminará con las heces los tripanosomas infectantes y de esa manera se reiniciará el ciclo evolutivo natural de la enfermedad (Storino y Milei, 1994). 8

25 CAPÍTULO I: INTRODUCCIÓN GENERAL Figura 1e: Ciclo de T. cruzi en el triatomino y el hombre. Fuente: VIRUS: CARACTERÍSTICAS GENERALES Los virus son parásitos intracelulares obligados, de muy pequeño tamaño. Replican dentro de las células que infectan utilizando para ello toda la maquinaria biosintética del hospedador. Dentro de la célula hospedadora apropiada, la expresión de la información contenida en el genoma viral dirige la síntesis de los componentes del virión y de las proteínas necesarias para su replicación. La progenie del virión ensamblado durante el ciclo infeccioso sirve para la transmisión de nuevos virus a la siguiente célula, donde es desensamblado, comenzando así, el siguiente ciclo infeccioso (Flint et al., 2004). El International Commitee on Taxonomy of Viruses (ICTV) reconoce actualmente la existencia de más de 3600 especies de virus, agrupándolas en más de 50 familias distintas (Fauquet et al., 2005). La clasificación de los virus se basa en la morfología del virión (la partícula vírica totalmente ensamblada e infectiva), la organización de su genoma, el modo de replicación y el número y tamaño de las proteínas estructurales y no-estructurales, 9

26 CAPÍTULO I: INTRODUCCIÓN GENERAL obteniendo de esa manera distintas familias y géneros (van Regenmortel., 2000). A su vez, las distintas especies de virus que pertenecen a una familia o género particular, se distinguen y definen en función de la divergencia genética, rango de hospedador natural, el tropismo celular, la patogenicidad, el modo de transmisión, las propiedades físico-químicas del virión o las propiedades antigénicas de las proteínas virales (Mahy y van Regenmortel, 2008) FAMILIA DICISTROVIRIDAE Inicialmente el virus fue clasificado dentro de los Picornaviridae: solo unos pocos virus ARN de insectos se habían clasificado dentro de esta familia (Muscio et al., 1988). Luego Czibener, en su tesis doctoral estudió el genoma de TrV, mediante el análisis de secuencias aminoacídicas del mismo, y comparándolo con los otros virus de insectos de características similares a TrV, evidenció que compartían caracteres como para proponerlo dentro del grupo de los Cricket paralysis like viruses (CrPV like-viruses), diferenciándolos de esta manera de la familia Picornaviridae, para luego pasar a componer la familia Dicistroviridae (Czibener, 2003; Czibener et al., 2000). Así, los Picornaviridae quedan restringidos a virus que afectan vertebrados, mientras la nueva categoría taxonómica tiene como hospedadores, únicamente a invertebrados. En la actualidad, el virus pertenece a la nueva familia Dicistroviridae (Mayo, 2002) cuya especie tipo es el virus de la parálisis del grillo, con un único género: Cripavirus. De acuerdo al International Commitee of Taxonomy of Viruses (ICTV), TrV es miembro de los Dicistroviridae, junto con otras 7 especies: Drosophila C virus (DCV), Aphid lethal paralysis virus (ABPV), Cricket paralysis virus, Black queen cell virus, Himetobi P virus, Plautia stali intestine virus y Rhopalosiphum padi virus (ICTV, 2002 on line). Los Dicistroviridae contienen un genoma ARN, monocatenario positivo, incluyéndose de esta manera dentro del grupo IV de la Clasificación de Baltimore (Fig. 1f). Algunos insectos comúnmente infectados por los Dicistrovirus incluyen áfidos, cicadellas, moscas, abejas, hormigas y polillas. Son virus de simetría icosaedrica, de 30 nm de diámetro y sin envoltura. Su nombre deriva de los dos ORF o cistrones que codifican el genoma viral. Hasta el momento existe solo un género denominado Cripavirus cuya 10

27 CAPÍTULO I: INTRODUCCIÓN GENERAL nominación deriva del virus de la parálisis del grillo. Se ha propuesto recientemente un segundo género: Aparavirus, pendiente de aprobación por el ICTV (Squires, comunicación personal). Este género debe su nombre al virus de la parálisis aguda de la abeja. Este género propuesto se distingue de acuerdo a la distancia filogenética y a la estructura particular de la región intergénica de sitio de entrada al ribosoma (IGR IRES) (Bonning y Miller, 2010). Figura 1f: Esquema de la organización genómica de los Dicistroviridae y Picornaviridae. Las cajas naranja, verde y violeta indican los ORF. En verde se representa el ORF2, responsable de la codificacion de las proteínas estructurales de los Dicistrovirus. Fuente: Bonning y Miller (2010). La estructura de los dicistrovirus consiste en partículas de simetría icosaédrica (PseudoT=3) con 60 copias de tres proteínas estructurales (VP1, VP2 y VP3). La VP4 que está codificada entre la VP2 y la VP3, es empaquetada como proteína de fusión con el N terminal de la VP3, formando en conjunto un anillo alrededor del eje del pentámero internamente (Bonning y Miller, 2010) (Fig. 1g). 11

28 CAPÍTULO I: INTRODUCCIÓN GENERAL Figura 1g: Estructura de los Dicistroviridae. Comparación de los pentámeros del virión del poliovirus y CrPV. (a) Pentámero del Poliovirus: Note el profundo cañónque rodea el eje de cinco puntas. Esto es necesario para la unión al receptor. (b)pentámero del virión del CrPV. Note que el virión del CrPV carece del cañón. (c) Corte a través del pentámero del CrPV, orientandose el interior del virión en la parte inferior de la figura. VP1, VP2, VP3, VP4, son de color azul, verde, rojo, y amarillo, respectivamente. Las principales características se indican en la figura. Fuente: Bonning and Miller (2010) TRIATOMA VIRUS (TrV): CARACTERÍSTICAS, TRANSMISIÓN Y CONTROL BIOLÓGICO Morfología, estructura y replicación La composición de los viriones de TrV es 35% de ARN y 65% de proteínas (Czibener et al., 2000). El ARN es de hebra simple y sentido positivo, con una longitud de bases y una masa molecular teórica de 2.886,4 12

29 CAPÍTULO I: INTRODUCCIÓN GENERAL KDa. El genoma posee dos marcos abiertos de lectura: ORF1 y ORF2 de 5387 y 2606 nt respectivamente, que codifican las proteínas no estructurales y de la cápside, separados por una región intergénica IGR- de 172 nt. Las proteínas no estructurales, se codifican en el primer marco abierto de lectura, próximo al extremo 5 y que viene precedido de una estructura de ARN que sirve como sitio interno de entrada al ribosoma (IRES) para la traducción de las proteínas virales (5 UTR IRES de 548 nt). El orden en el ORF 1 es el siguiente: helicasa, proteasa, ARN polimerasa ARN dependiente. Desde el nt 5936 al nt 6109 se halla una región intergénica no codificante de 172 nucleótidos de largo y en ambos extremos 5 y 3, se encuentran regiones no codificantes denominadas UTR, de 550 y 295 nucleótidos respectivamente (Czibener et al., 2000; 2005) (Fig. 1h). Figura 1h: Esquema de la estructura genómica de TrV. El ORF1 comineza en el nucleótido 549, con 5387 nt. La región intergénica, de 172 nt, abarca del nt 5936 al El ORF2 con 2606 nt. Fuente: Czibener et al., (2000). El ORF 2 codifica las proteínas estructurales del virión denominadas VP1, VP2 y VP3, cuyas masas teóricas son de 29,7 KDa; 28,4 KDa y 31,8 KDa respectivamente. La cuarta proteína, denominada VP4, tiene una masa teórica de 5,5 KDa. Agirre en su trabajo de tesis concluye que la VP0 es una de las proteínas mayoritarias en la composición de las cápsides vacias, encontrando además otras bandas de mayor y menor movilidad electroforética que las proteínas canonicas del virus. La presencia de una mayor concentración de VP0 en la muestra de cápsides vacias sugiere que el corte catalítico de VP0 esta asociado a la encapsidación del ARN (Agirre, 2009; Agirre et al., 2011). Cada ORF es traducido a una poliproteína la cual es subsecuentemente clivada por proteasas en proteínas individuales. Del mecanismo de replicación de TrV poco se conoce. Se cree que utiliza 13

30 CAPÍTULO I: INTRODUCCIÓN GENERAL el mismo mecanismo que los picornavirus. Sin embargo, el virión a diferencia de los picornavirus, carece de la estructura denominada cañón, y aunque se desconoce el receptor celular de los dicistrovirus, se sabe que la entrada ocurre por endocitosis mediada por clatrina. El mecanismo de replicación estudiado es el de los discistrovirus en general. Luego de entrar a la célula, el virus se desnuda, liberando el ARN genómico al citoplasma (Bonning y Miller, 2010). El ARN de los dicistrovirus no posee el CAP en el 5 por lo cual se traduce por medio de estructuras conocidas como IRES. El IRES es una estructura de ARN del genoma viral que recluta los ribosomas al ARNm sin requerimiento del CAP para que el ribosoma escanee desde el 5. Los dicistrovirus tienen dos IRES muy distintos pero bien caracterizados que facilitan la traducción de los dos ORFs: en el 5, uno llamado UTR IRES (río arriba del ORF 1) y el segundo en la región intergénica, el IGR IRES (río arriba del ORF 2). Ambos son diferentes entre sí, y diferentes entre otros IRES y realizan la traducción de cada ORF por separado. El IGR IRES es uno de los mejores caracterizados hasta el momento. En contraste al IGR IRES, el 3 UTR IRES de los dicistrovirus no tiene una estructura conservada. El UTR si necesita de factores de iniciación, y el IGR no. Los genomas dicistrónicos de los dicistrovirus han revelado un mecanismo totalmente nuevo de traducción en eucariotas. La región IGR IRES facilita la traducción en ausencia de factores de iniciación imitando al trna (Schuller et al., 2006). Distintos estudios bioquímicos y genéticos demostraron que la región IGR IRES del CRPV es capaz de unirse a las subunidades ribosomales 40S en ausencia de factores de iniciación de la traducción GTP y trna-met (Deniz et al., 2009). La unión del IGR IRES a la subunidad 40S resulta en un cambio conformacional de esta subunidad y permite la apertura del canal de unión al mensajero (Passmore et al., 2007). Este cambio conformacional demuestra que el IRES es capaz de manipular al ribosoma y sugiere que el IRES funciona como un factor de traducción basado en ARN (Kieft, 2008). La región 5 UTR IRES actúa por un mecanismo clásico utlizando factores de iniciación (Roberts y Gropelli, 2009). Cabe destacar que la iniciación de la traducción en el segundo ORF no es necesariamente AUG-dependiente. Otros aminoácidos han sido encontrados como residuos N-terminal del ORF 2 en CRPV y DCV, alanina y en TrV, leucina (Masoumi et al., 2003; Herts y Thompson, 2011). 14

31 CAPÍTULO I: INTRODUCCIÓN GENERAL Transmisión natural de TrV De acuerdo a los estudios realizados hasta el momento, TrV puede transmitirse principalmente por vía horizontal, mediante la ruta fecal-oral, como así también por una vía vertical (transovárica) (Marti, 2005; Muscio et al., 1997; 2000). Las observaciones realizadas por Muscio en 1988 indican la presencia de partículas de TrV en células epiteliales del intestino medio de T. infestans. Dicho virus replica en el citoplasma de las células intestinales, induciendo pronunciadas alteraciones en mitocondrias y membranas celulares en aproximadamente 6 hs luego de su inoculación intrahemocélica (Muscio, 1987). Coincidiendo con estas observaciones, posteriormente mediante estudios histopatológicos se corroboró la presencia de TrV en células epiteliales del intestino medio, buche y en las gónadas femeninas de T. infestans mientras que por observaciones al microscopio electrónico solo observaron partículas virales en epitelio intestinal (Marti, 2005). Por el hábito gregario de los triatominos al momento de alimentarse la transmisión fecal-oral adquiere una mayor importancia en la transmisión. Este comportamiento densodependiente se puede observar en las colonias de T. infestans con TrV en el laboratorio del CEPAVE que ante la incorporación de insectos libres de TrV rápidamente se infectan con el virus. Especies susceptibles a TrV La susceptibilidad de las especies se ha determinado por vía oral, vía intrahemocélica y por infecciones naturales encontradas en el campo. Por vía oral (ingesta de partículas virales) se observó la susceptibilidad en T. infestans (Muscio, 1988; Rozas-Dennis y Cazzaniga, 2000; Marti, 2005); T. guasayana (Rozas-Dennis, 2007) y T. patagonica (Rozas-Dennis et al., 2002). Por vía intraehemocélica TrV replicó en todas las especies inoculadas: T. infestans, T. platensis, T. delpontei, T. pallidepennis, T. rubrovaria y R. prolixus (Muscio, 1988). Muscio (1988) menciona la presencia de TrV en T. infestans capturados en un peridomicilio en la provincia de Córdoba. Posteriormente en la misma región fue encontrado por el Dr. Marti (2005); y luego de varios años de muestreo en el laboratorio del CEPAVE se ha registrado en T. infestans en 8 provincias en domicilios y peridomicilios y en T. sordida en un domicilio de la 15

32 CAPÍTULO I: INTRODUCCIÓN GENERAL provincia de Chaco (Marti et al., 2009). Teniendo en cuenta las tres vías de infecciones por TrV, la nómina de especies susceptibles es de nueve y en la naturaleza se restringe solamente a T. infestans y T. sordida. Hasta la fecha, no se han publicado los estudios inherentes a la búsqueda de TrV en Latinoamérica. Los datos existentes son únicamente de Argentina. Control biológico: los virus como posibles agentes de control biológico y el caso de TrV El control biológico o la regulación de la población por acción de enemigos naturales ofrece una buena alternativa para reemplazar el uso de productos de síntesis, que pueden ser eficientes en mediano y largo plazo y que raramente desarrollan resistencia, además estos métodos son altamente selectivos y seguros para el medio ambiente (Huffaker et al., 1971). La introducción o el incremento de enemigos naturales en poblaciones naturales de las principales especies transmisoras de Chagas, podría lograr con el tiempo la reducción del número de vectores a niveles que aseguren la interrupción de la transmisión del parásito en la población susceptible (Marti, 2010). Los insecticidas que se han utilizado hasta el presente para controlar a los vectores de la enfermedad de Chagas, acarrean múltiples problemas: no se aplican de manera correcta, no son selectivos debido a que eliminan tanto a enemigos naturales de los triatominos como a otras especies benéficas para el ser humano, producen un gran deterioro en el medio ambiente, y lo más relevante es que los insectos cada vez son más resistentes a dichos insecticidas (Picollo et al., 2005; Santo Orihuela et al., 2008; Toloza et al., 2008; Germano et al., 2010a; Germano et al., 2010b; Lardeux et al., 2010; Zerba 1999; Segura et al., 2001). Además los costos de los insecticidas se incrementan constantemente, existen grandes riesgos de intoxicación para los operarios que los aplican (Casida y Quistad 1995; Elliot 1995; Perry 1998; Naumann 1990) y se ha documentado que al interrumpir los programas de control en zonas rurales del noroeste de la argentina, basados en el uso exclusivo de insecticidas, las poblaciones de T. infestans han llegado a la densidad de individuos previa a las aplicaciones de químicos en un período aproximado de 2 años (Cecere et 16

33 CAPÍTULO I: INTRODUCCIÓN GENERAL al., 2003). Una larga lista de triatominos que excede las 60 especies han sido halladas en la naturaleza afectadas por depredadores, parasitoides, ecto y endoparásitos y patógenos, así como otras asociaciones simbióticas (Jenkins, 1964; Barrett, 1976; Roberts y Strand, 1977; Lent y Wygodzinsky, 1979; Roberts, 1980; Daoust, 1983; Ryckman y Blankenship, 1984; Weiser, 1991; Marti, 2010). El Triatoma virus (TrV), como se mencionó anteriormente, es el único virus entomopatógeno identificado en triatominos hasta el momento (Muscio et al., 1987). Utilizando microscopía electrónica otros investigadores han encontrado algunas partículas similares al virus que forman matrices paracristalinas en las células del tubo Malppighi y fibrillas intranucleares de especímenes de T. infestans y Panstrogylus megistus de Brasil (Dolder y Mello, 1978 a, b), pero estas partículas no fueron descriptas en detalle. Sin embargo no es probable que estas partículas correspondan a TrV debido a que no tienen efectos biológicos sobre estos insectos. Trabajos previos que sustentarían el uso de TrV como control biológico, serían el registro de porcentajes superiores al 90% de mortalidad en el laboratorio en estados ninfales de T. infestans infectados con TrV (Muscio et al., 1997); así como la variación en la duración del estadío ninfal entre ejemplares sanos e infectados. El registro fue de 100 días (Perlowagora Szumlewicz, 1976), 141 días (Rabinovich, 1972), y 166 días (Carcavallo, 1972), siendo de 286 días la duración del estado ninfal en insectos infectados con TrV (Marti, 2005). Por otro lado, Rozas-Dennis y Cazzaniga (2000) observaron que la infección con TrV reduce la longevidad y la fecundidad de las hembras adultas, y que las ninfas infectadas muestran parálisis en las patas y dificultad para desprenderse de la exuvia. Actualmente los principales esfuerzos para combatir al vector de la enfermedad es la utilización de piretroides (sustancias químicas de estructura similar a las piretrinas, letales para los insectos, pero de gran persistencia en el ambiente). Es por ello, que uno de los aspectos interesantes en emplear a TrV como agente de control de triatominos, es que este método complementaría a los métodos al presente existentes basados en el rociado domiciliario con insecticidas piretroides: 1) Existen estudios que indican la aparición de resistencia, así 17

34 CAPÍTULO I: INTRODUCCIÓN GENERAL como estudios que demuestran la existencia de dicha resistencia a los insecticidas empleados en las fumigaciones domiciliarias (Vassena, et al., 2000; Picollo et al., 2005; Cecere et al., 2006 a, b; Porcassi et al., 2006; Fabro et al., 2012; Germano et al., 2012; Carvajal et al., 2012). En la última década, sin embargo, diferentes niveles de resistencia a piretroides se han detectado en Bolivia, el sitio de origen y dispersión de T. infestans (Panzera et al., 2004), y en algunas zonas vecinas de Argentina (Santo Orihuela et al., 2008). En otros vectores de enfermedades, la reducción de la penetración, el aumento de las capturas, la resistencia metabólica y las alteraciones en el sitio de destino, como la modificación de la conducta, son unos de los mecanismos reconocidos de la resistencia (Ranson et al., 2002). 2) Incrementar la infección natural con TrV resulta interesante, ya que naturalmente el virus se dispersaría infectando también a insectos peridomiciliarios y silvestres. 3) Contrariamente a lo que ocurre con los insecticidas convencionales que poseen un limitado poder residual (Cecere et al., 2006a), el poder residual de TrV empleado como insecticida sería inestimablemente prolongado, ya que una vez instalada la infección viral esta se propagaría indefinidamente por descendencia y transmisión horizontal. Por otra parte, los aspectos negativos en las campañas de rociado indicados anteriormente y la perspectiva que esas dificultades se agraven, ha motivado a que la búsqueda de nuevos métodos de control de triatominos, tanto en domicilio como en peridomicilio, haya sido identificada como un área prioritaria de investigación (WHO-TDR, 2005). Las campañas de rociado se basan exclusivamente en la eliminación de T. infestans en Sudamérica, sin embargo, diversas especies de triatominos que son silvestres o que habitan los peridomicilios (denominadas especies secundarias) y que no son actualmente el objetivo del control de la transmisión de la enfermedad de Chagas, podrían convertirse en vectores de T. cruzi, durante o después de la eliminación de T. infestans de los domicilios como resultado del tratamiento con insecticidas piretroides (Carcavallo y Martínez, 1985; Noireau et al., 1999; 2000; Cecere et al., 2002). Debido a que, de las tres vías más frecuentes de contagio de T. cruzi, la vectorial es la predominante en el área endémica, es imprescindible profundizar aún más en el conocimiento de los insectos hospederos, para 18

35 CAPÍTULO I: INTRODUCCIÓN GENERAL optimizar su control. Si bien no es uno de los objetivos de este trabajo de tesis, el desarrollo de la misma, permitirán ampliar el estudio del virus para llegar a utilizarlo en un futuro, como ya se ha mencionado, como agente de control biológico. 19

36 CAPÍTULO I: INTRODUCCIÓN GENERAL 1.2- HIPÓTESIS Con estas herramientas se plantean las siguientes hipótesis: Triatoma virus en la naturaleza es específico de T. infestans y excepcionalmente se encuentra en otros triatominos: el hallazgo en T. sordida fue accidental. TrV está asociado a T. infestans que se encuentran en domicilio y peridomicilio donde las poblaciones son más numerosas facilitando la transmisión por el hábito gregario al momento de alimentarse. TrV presenta variabilidad genómica de acuerdo a la distribución geográfica de la especie de triatomino. TrV presenta variabilidad genómica dependiendo de la especie de triatomino que se esté analizando. La obtención de virus mediante su replicación en cultivos celulares y cultivos primarios proporcionará una masa viral de mejor pureza y a mayor escala para estudios posteriores 1.3- OBJETIVOS GENERALES Y ESPECÍFICOS A partir de estas hipótesis, se proponen los siguientes objetivos: Objetivo general 1: Estudiar la diversidad de TrV en triatominos de Argentina de acuerdo a su distribución geográfica por medio de análisis de secuencias genómica. Objetivos específicos: o Obtener secuencias de TrV en especies de triatominos de Argentina. o Analizar mediante programas informáticos las diferentes secuencias de TrV según su distribución geográfica. o Analizar si se encuentran diferencias entre las secuencias aisladas de en T. infestans respecto a otras especies de triatominos. 20

37 CAPÍTULO I: INTRODUCCIÓN GENERAL Objetivo general 2: Obtener un sistema para la replicación de TrV in vitro Objetivos específicos: o o Obtener TrV in vitro mediante inoculación de cultivos celulares adecuados. Obtener TrV in vitro mediante cultivos primarios de T. infestans libres de TrV. 21

38 CAPÍTULO I: INTRODUCCIÓN GENERAL 1.4- RELEVANCIA DE LA INVESTIGACIÓN Desde el año 2008, con la finalidad de incrementar los estudios existentes sobre TrV, se continuó con la búsqueda de este virus en poblaciones naturales de T. infestans, el principal vector de la enfermedad de Chagas en Argentina, enfatizando la búsqueda en poblaciones de triatominos silvestres. Este trabajo de tesis ampliará la información sobre la diversidad y distribución de virus mediante el análisis de secuencias pudiendo así, conocer si el virus posee cambios en su genoma, dependiendo de la especie o el lugar geográfico que se analice. Además, contar con líneas o cultivos celulares sensibles a la infección con TrV permitirá aislar, caracterizar y producir grandes cantidades de virus que podrían ser utilizados como herramienta fundamental en su utilización como un posible agente de control biológico. En el Centro de Estudios Parasitológicos y de Vectores (CEPAVE) se aisló por primera vez este virus en el año 1987 y desde entonces se mantuvo una continuidad en las diferentes investigaciones, las cuales durante el 2008 se comenzaron a profundizar en nuestro laboratorio, formando un consorcio con investigadores de otros países, con la iniciativa de formar una Red Temática. Cabe destacar que el tema es de significativo interés tanto para la Argentina, como para el resto de los países de América Latina, y Europa que finalmente forman parte de la Red Iberoamericana para el Estudio del Control Biológico con TrV de Triatominos Transmisores de Chagas (REDTrV: Esta red integrada por 32 grupos de investigación de 16 países y 3 empresas, bajo un convenio con el CYTED que comenzó en el 2009 ( y tiene como objetivo desarrollar un nuevo sistema de control de los vectores transmisores de Chagas a través de un biopesticida basado en TrV. TrV es uno de los patógenos mejor estudiados, principalmente en condiciones de laboratorio, siendo escasa la información sobre el sistema hospedador-parásito en la naturaleza. El control biológico puede ser una alternativa válida en los programas de control de triatominos a largo plazo en las zonas endémicas de Argentina. Como ya hemos mencionado, la introducción o el incremento de la densidad de enemigos que naturalmente disminuyen las poblaciones de estos insectos, 22

39 CAPÍTULO I: INTRODUCCIÓN GENERAL puede lograr en el tiempo, la reducción del número de vectores a niveles que aseguren la interrupción de la transmisión de la enfermedad. 23

40 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS CAPÍTULO II DIVERSIDAD DE TrV EN TRIATOMINOS DE ARGENTINA 2.1- ANTECEDENTES El rango hospedador fisiológico en laboratorio, tanto por vía oral por medio de la ingesta de partículas de TrV, como por vía intrahemocélica por medio de inoculaciones de partículas de TrV, es mucho más amplio que el rango hospedador ecológico que son los hallazgos de triatominos en el campo con presencia de partículas de TrV. En su tesis doctoral, el Dr. Muscio, observó insectos del insectario que morían de forma súbita luego de recibir alimento a repleción y luego de analizar estos insectos pudo identificar unas partículas al Microscopio Electrónico que eran muy similares a las que habían encontrado en triatominos provenientes del paraje Media Naranja de la Provincia de Córdoba. Así, en febrero de 1986, se cita por primera vez al único virus entomopatógeno hallado e identificado en triatominos hasta el presente (Muscio et al., 1987). Posteriormente se estudió la incidencia de TrV en poblaciones de T. infestans de domicilios y peridomicilios en diferentes localidades de la zona endémica de Córdoba (Argentina), dando como resultado un porcentaje de infección de 1% a 10% (Muscio et al., 1997). Durante una prospección realizada durante el período se encuentra a TrV nuevamente en poblaciones naturales de T. infestans en la provincia de Córdoba, y además en las provincias de San Luis, Mendoza, Tucumán, La Rioja, Santa Fe, Santiago del Estero y Salta. En la provincia de Chaco se halla T. sordida la cual es citada como la segunda especie observada en la naturaleza (Marti et al., 2009) MATERIALES Y MÉTODOS TRABAJO DE CAMPO Las colectas fueron procesadas a fines prácticos en dos grupos, triatominos silvestres y triatominos de domicilio y peridomicilio. Esto es debido a que número de ejemplares que se colectan en cada uno de estos ambientes 23

41 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS es muy variable y es diferente la manera que se utilizó para realizar su colecta (colectas activa y pasiva, ver y ). Por ende, los insectos fueron procesados de diferente manera si se trataba de poblaciones numerosas de T. infestans procedentes de domicilio o peridomicilio (pooles) o si se trataba de T. infestans u otra especie del ambiente silvestre (individuales) (ver ) COLECTA DE TRIATOMINOS SILVESTRES Las colectas de triatominos silvestres se llevaron a cabo en las provincias de Chaco y La Rioja (Argentina). Ambas pertenecen al Dominio Chaqueño, dentro de la Región Neotropical, que abarca gran parte del territorio argentino (Fig. 2a y Fig. 2b). En cada muestreo se realizaron capturas de triatominos en microhábitats que para la región chaqueña ya se habían descripto con anterioridad. Varias especies de triatominos (T. delpontei, T. garciabesi, T. guasayana, T. platensis, etc.) fueron halladas en nidos de aves, refugios de mamíferos, cactáceas, bromeliáceas y cortezas de árboles (Wisnivesky et al., 1997). Estas capturas se realizaron tanto por búsqueda activa, empleando desalojante (tetrametrina 0,2%), como por búsqueda pasiva utilizando trampas de luz y trampas Noireau. 24

42 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Fig. 2a: Paisajes de la Provincia de Chaco. Fig. 2b: Paisajes de la Provincia de La Rioja. 25

43 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Áreas de muestreo Durante el período 2008 a 2011 se realizaron las campañas de colectas de triatominos durante los meses con temperaturas más cálidas (primaveraverano) que son meses sumamente propicios para la expansión de las poblaciones de triatominos, favoreciendo de esta manera el desarrollo de enfermedades producidas por parásitos y patógenos. Durante estos años se realizaron 4 viajes a la provincia de Chaco y 3 viajes a la provincia de La Rioja (Fig. 2c). El área de muestreo en la provincia de Chaco y La Rioja, pertenecen a la gran región biogeográfica Neotropical; Dominio Chaqueño. Para las regiones fitogeográficas se sigue el criterio de Engler, modificado por Mattick, 1964 y para el caso de las regiones zoogeográficas, la clasificación clásica de Sclater y Wallace, con algunas modificaciones posteriores, hasta llegar a la de Darlington. La provincia de Chaco comprende sectores de la denominada Provincia Chaqueña, una de las provincias de mayor volumen de vegetación. El clima es subtropical, con precipitaciones anuales de 450 mm y la temperatura media varía entre 13ºC y 28ºC, con máximas absolutas de 43ºC. El tipo de vegetación predominante es el bosque xerófilo caducifolio, un estrato herbáceo de gramíneas y numerosas cactáceas y bromeliáceas terrestres. Pero hay también palmares, sabanas y estepas arbustivas halófilas. El paisaje se caracteriza por la presencia de Schinopsis balansae (quebracho colorado), por lo general asociados con Aspidosperma quebracho (quebracho blanco), Caesalpinia paraguarirensis (guayacán), Tabebuia avellanedae (lapacho), Cercidium praecox (brea), Prosopis kuntzei (itin), Zizyiphus mistol (mistol). También aparecen con frecuencia palmares, entre ellas, Copernicia australis y colonias de la palmera Trithinax campestris. Además bromelias y opuntias, entre otras. La Provincia Chaqueña se encuentra muy alterada por la intensa explotación forestal y ganadera, donde en muchas zonas no solo ha desaparecido el bosque primitivo, sino también el estrato herbáceo, quedando algunos arbustos espinosos, bromeliáceas y cactáceas. En cuanto a la fauna que habita la región, encontramos entre los marsupiales, la comadreja overa (Didelphis azarae) de amplia distribución, la comadreja colorada (Lutreolina crassicaudata) y varias marmosas. Además 26

44 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS hay zorros (Cerdocyon y Dusicyon) el aguará- guazú (Chrysocyon) uno de los animales más representativos de la zona, un coatí (Nasua), el hurón menor (Galictis) y el hurón mayor (Eira), el yaguareté (Felis onca), algunos monos como el aullador (Alouatta caya) que es otra de las especies típicas de la región, el miriquiná (Aotus) y el caí (Cebus). Hay muchos roedores: la rata nutria (Holochilue brasiliensis), ratas (Scapteromys, etc), tuco-tucos (Ctenomys), la vizcacha (Lagostomus), etc. También se encuentra el ciervo de los pantanos (Blastocerus dichotomus), el venado de las pampas (Ozotocerus) y dos especies de corzuelas (Mazama). Hay varios edentados como el pichiciego chaqueño (Burmeisteria retusa), el quirquincho bola o mataco (Tolypeutes matacus), el tatu carreta (Priodontes giganteus), el gigante de los armadillos cuyo número disminuye rápidamente, el peludo grande (Euphractus), la mulita grande (Dasypus) y el tatu de rabo molle (Cabassous), además están representados el oso hormiguero (Myrmecophaga), el oso melero (Tamandua) y el perezoso (Bradypus). Hay citadas mas de 200 especies de aves en esta provincia; siendo las más representativas: las chuñas (Chunga burmeisteri y Carioma cristata), perdices del genero Nothura, la martineta (Eudromia), la charata (Ortalis), la pava del monte (Penelope), el jaribú (Jaribu micteria), garzas blancas (Egretta), hornero (Furnarius cristata), cotorras y loros (Myiopsitta, Nandaryus), carpinteros (Chrysoptilun). Varias especies de boas y ampalaguas. Cerca de 50 colubridos, además de dos especies de cascabel y yarará. La fauna de anfibios llega a 32 especies; de estas, dos son endémicas: la rana (Leptodactylus laticeps) y el escuerzo (Ceratophrys pierotti) (Cabrera y Willink, 1973). La provincia de La Rioja pertenece a la Provincia del Monte que ocupa una gran extensión de las regiones más áridas de la Argentina. El clima es siempre seco y cálido en la porción septentrional y más fresco en la meridional. La precipitación varía de 80 a 250 mm anuales, mientras el promedio anual de temperatura oscila entre los 13 a 15,5 C. A pesar de la gran extensión que abarca la Provincia de Monte, tanto la fisonomía de la vegetación como la composición florística son bastante homogéneas. Domina el matorral, muchas veces abierto, donde predominan zigofiláceas (Larrea, Bulnesia y Plectrocarpa), como las jarillas del género Larrea, rodajilla 27

45 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS (Plectrocarpa rougessi), matasebo (Monttea aphylla), el monte negro (Bougainvillea spinosa), la pichana (Cassia aphylla), la brea (Cerdidium praecox), la chilladora (Chuquiraga erinacea), el alpataco (Prosopis alpataco), retamo (Bulnesia retama), y muchas otras especies arbustivas. En cuanto a la fauna, los mamíferos característicos son la comadreja overa (Didelphis azareae), el ratón de palo (Marmosa pusilla), murciélagos (Histiotus, Myotis, Tadarida, Eumops), hurones (Lyncodon y Galictis), zorros (Dusicyon), zorrinos (Conepatus), gato montés de las salinas (Felis geoffroyi salinarum), yaguarundí (Felis yagouarundy), el gato de los pajonales (Felis pajeros) y el puma (Puma concolor). Los roedores son numerosos: maras (Dolichotis patagonum), cuises (Microcavia), ratas, pericotes y ratones (Reithrodon, Phyllotis, Eunemys, etc). Entre los armadillos, el más típico y endémico de la familia es el pichiciego (Chlamyphorus truncatus); el mataco (Tolypeutes matacus), dos especies de peludos (Chaetophractus villosus y Ch. vellerosus) y el piche llorón (Zaedyus pichiy). En cuanto a las aves, encontramos perdices (Nothoprocta cinerascens) y martinetas (Eudromia elegans), el loro barranquero (Cyanoliseus patagonum), catas serranas (Bolborhynchus aurifrons), el gallito o corredora (Teledromus fuscus), monterito (Poospiza ornata) y otras. Hay varias especies de reptiles: la boa de las vizcacheras (Constrictor constrictor), la víbora de coral (Micrurus), la yarará (Bothrops) y algunas culebras; lagartijas, iguanas geckonidos y una tortuga terrestre, etc. Entre los batracios se pueden citar especies de Leptodactylus, Pleurodema y Bufo (Cabrera y Willink 1973). 28

46 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Fig. 2c: Mapa de la República Argentina exponiendo las zonas muestreadas de provincias de Chaco y La Rioja. Métodos de captura Captura activa Los ecotopos silvestres donde se realizaron las búsquedas se restringieron a nidos de aves (principalmente de furnánidos y psitácidos), cactáceas (cardones secos), bromeliáceas y cortezas de árboles. 29

47 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS En el caso de los nidos de aves, se llegó hasta el nido con la ayuda de una escalera metálica plegable de 6 metros de alto y ayudado con una varilla de aluminio para los nidos que superaban esa altura. Luego de bajar el nido para el desarme se utilizó una cubeta plástica blanca de 100 cm x 40 cm x 24 cm, y para los nidos extremadamente grandes se colocó debajo una lona plástica blanca de 1,5 x 4 m. Luego del desarme se extrajeron con guantes y pinzas cuidadosamente cada uno de los insectos (Fig. 2d). Fig 2d: Arriba: Nido de Furnariidae: secuencia desde que se busca en el árbol hasta que se coloca en la cubeta plástica. Abajo izquierda: búsqueda de triatominos en nidos de Psittacidae. Cuando el lugar de búsqueda fueron las cactáceas, chaguares, bromeliáceas o cortezas de árboles, estas se movieron cuidadosamente y se buscaron los insectos con la ayuda de pinzas metálicas y desalojante cuando fue necesario (Fig. 2e). 30

48 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Fig. 2e: Búsqueda de triatominos en ambiente silvestre. Arriba: paisaje mostrando cactáceas. Abajo izquierda: cortezas de árboles; a la derecha chaguares. Captura pasiva Para este tipo de colectas se utilizaron dos tipos de trampas: Trampas Noireau Se utilizaron 20 trampas que fueron expuestas durante toda la noche, tres días en cada zona de muestreo. En la provincia de Chaco, ambas zonas de muestreo se realizaron en la localidad de El Palmar (Palmar 1 y Palmar 2); mientras que en las provincias de La Rioja la zona de muestreo estuvo situada en dos localidades, Patquia Viejo y Salinas de Bustos. Estas trampas contenían un ratón adulto (macho o hembra) Balb/c, como cebo dentro de un recipiente plástico, y una malla metálica tapando la abertura del mismo. Alrededor del recipiente se colocó adhesivo externamente, para la captura de los triatominos, que en busca de su alimento quedaron adheridos al mismo (Noireau et al., 1999a; Abad-Franch et al., 2000) (Fig. 2f y 2g). 31

49 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2f: Trampa Noireau colocadas entre piedras. Provincia de La Rioja. Figura 2g: Preparación de Trampas Noireau para su posterior colocación. 32

50 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Dentro del recipiente junto al ratón se colocó aserrín, alimento balanceado y un trozo de zanahoria para evitar la deshidratación del roedor, debido a las altas temperaturas. En la provincia de chaco estas trampas se colocaron en dos zonas de la localidad de El Palmar. Se situaron en las pocas parcelas de monte virgen que quedan limitando las zonas de cultivo: entre bromelias, en árboles caídos, cercanos a cuevas de mamíferos. En la provincia de La Rioja, las trampas se colocaron en dos zonas, una en la localidad de Patquia Viejo donde se colocaron asociadas a palmeras, tanto en la copa de las mismas como cerca del sustrato (Fig. 2g) y otras en la localidad de Salinas de Bustos que al ser tan distinta la fisonomía del lugar, se eligió una zona de piedras (Fig. 2f). En ambas zonas las trampas fueron colocadas al resguardo, tanto de posibles predadores como de las radiaciones solares. Trampas de luz Se utilizaron 8 trampas de luz ubicadas cada 100 m, cubriendo una transecta de 800 m. Estas transectas fueron ubicadas en las mismas cuatro lacalidades (tres noches en cada localidad) en donde se ubicaron las trampas Noireau. Se colocaron durante el ocaso, en un período de 4 horas, durante 6 noches para cada una de las provincias, en cada viaje realizado (fig. 2h). Figura 2h: Esquema de la organización de las trampas de luz en el campo. T.L= Trampa de Luz; G.E= Grupo Electrógeno. Cada trampa de luz se compone de una varilla de hierro en forma de ele de 1,30 m de altura que sostiene en su extremo una lámpara de 100 watts de potencia. Los insectos al ser atraídos por la luz caían en un embudo de 60 cm de diámetro sostenido a la varilla con un aro de hierro y apoyado sobre un balde de 8 litros (Fig. 2i). La energía para las lamparitas, fue suministrada por un grupo electrógeno naftero portátil Logus Gg

51 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Pasadas las cuatro horas, se procedió a la recolección de los insectos. Esto se realizó buscando en cada balde plástico, los triatominos, descartando en otros recipientes el resto de los artrópodos que cayeron atraídos por la luz. Los triatominos atrapados se colocaron en los recipientes como en el resto de las capturas y se transportaron al laboratorio. Figura 2i: Trampa de Luz. Provincia de La Rioja COLECTA DE TRIATOMINOS EN DOMICILIO Y PERIDOMICILIO Las colectas de triatominos de domicilio y peridomicilio se llevaron a cabo en las provincias argentinas de Chaco, La Rioja, Santa Fe y Córdoba, durante el período En cada muestreo se realizaron capturas exclusivamente por búsqueda activa, en los domicilios y en el peridomicilio principalmente. EL peridomicilio se define como el área que circunda a la vivienda humana y en el cual el hombre desarrolla sus actividades domésticas y mini productivas. Se incluyeron bajo este concepto todos los depósitos, corrales de animales, flora, etc., los cuales podrían actuar como paso previo a la colonización del domicilio 34

52 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS por triatominos silvestres. Estas estructuras de alambres, palos, ladrillos, plásticos, entre otras, resguardan no solo animales de cría sino también animales domésticos (Canale et al., 2000; Cecere et al., 1997; Bos 1988) (Fig. 2j). 35

53 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2j: Lugares de colecta en el peridomicilio. Provincia de Chaco (arriba): corrales de cabras y nidos de palomas (arriba, derecha). Provincia de La Rioja (abajo): corrales de cabras de distintos materiales. Áreas de muestreo Durante el período 2008 a 2010 se realizaron los muestreos en las provincias de Chaco, La Rioja, Santa Fe y Córdoba. En el caso de las provincias Chaco y La Rioja, durante los días que se realizaron las colectas de triatominos silvestres, se obtuvieron muestras de domicilio y peridomicilio cercanos. Se colectaron además triatominos de ambientes domiciliario y peridomiciliario en localidades de Santa Fe y Córdoba. La especie mayormente hallada en estos ambientes fue Triatoma infestans, que es una especie domiciliaria y su hábitat más importante son los ecotopos creados o modificados por el hombre. En la zona donde se realizaron los muestreos, generalmente los ranchos son de adobe con techos de chapa, plásticos o paja, con paredes de barro o de ladrillos mal revocados o sin revocar, que presentan grietas o quebraduras dejando lugares propicios para que se alojen los triatominos, así como en muebles, camas, cajas, pilas de ropa en desuso, etc. De esta forma, se asocia a los triatominos de hábitos 36

54 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS domiciliarios a condiciones sociales higiénicas deficientes, aunque también se encuentran en viviendas de buena calidad con malas condiciones de higiene. Debido a que el peridomicilio es una pieza fundamental en el proceso de adaptación al hábitat humano, ya que muchas especies lo utilizan como una transición entre el hábitat silvestre y doméstico, los triatominos representan un riesgo epidemiológico debido a la capacidad potencial que tienen para reemplazar a los vectores domiciliarios ocupando de este modo el nicho ecológico dejado por estos después de su eliminación (Wisnivesky-Colli et al., 1993). Otros autores señalan la importancia del peridomicilio en la reinfestación de las viviendas, luego de ser eliminadas las especies domiciliarias (Cecere et al., 1996; Cecere et al., 1997; Zeledon y Rabinovich, 1981). Así, el peridomicilio constituye para estos triatominos un hábitat favorable ya que este ambiente posee una disponibilidad y acceso a la fuente alimentaria mucho mayor que el ambiente selvático. El primer paso en este proceso de adaptación domiciliaria es cuando especies selváticas comienzan a usar como hábitat frecuente el peridomicilio humano y por lo tanto los animales que se encuentran en él como fuente alimentaria. Perros, gatos y otros mamíferos como cabras, ovejas, conejos, cerdos, al ser fuente de alimentación de los triatominos infectados con T. cruzi, se constituyen en reservorios hospederos del parásito. A estos se pueden agregar múridos sinantrópicos, comadrejas, zorrinos, hurones, murciélagos y el propio hombre cuando contacta con estos vectores, a reposar por ejemplo, en galpones. En nuestras regiones de muestreo, se citan al perro, la zarigüeya y los roedores como los probables hospederos reservorios más importantes dentro del ciclo peridomiciliario (Diosque et al., 2003; 2004). Además de otros estudios realizados en nuestro país que han demostrado la importancia del perro como reservorio intradomiciliar en la transmisión del parásito por T. infestans (Gürtler et al., 1998). Métodos de captura Captura activa Las capturas se realizaron en viviendas y alrededores. Se revisaron principalmente, los lugares donde había restos de materia fecal de triatominos, fácilmente reconocibles por su color y materialidad. Se buscó 37

55 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS exhaustivamente en las grietas de adobe, rajaduras de las paredes, espacios entre materiales en desuso, y otros ambientes similares. Cuando fue necesario se utilizó un agente desalojante en aerosol. Esto es debido a que hay lugares donde es difícil el acceso a estos insectos, dificultándose su captura y siendo necesaria la ayuda de este irritante para que salgan de sus refugios (Fig. 2k). Así, se buscaron triatominos cerca de las casas, en corrales de cabras, mulas, conejos y cerdos; gallineros, palomares, depósitos, pilas de leña y árboles donde duermen gallinas. Principalmente se recolectó en gallineros, previo desarme de los mismos, ya que estos ambientes poseen poblaciones numerosas de insectos en un área restringida (Marti, 2005). Las gallinas tienen especial importancia como hospedadores de triatominos, si bien las aves son refractarias a la infección con T. cruzi permiten un estado nutricional óptimo de las poblaciones de triatominos y mantienen un elevado número de individuos. López et al., 1999, detalla en su estudio llevado a cabo en dos regiones endémicas de la región central de Argentina, en la provincia de Santiago del Estero, municipio de Atamisqui, y en el municipio de Quilino en la provincia de Córdoba, que los gallineros más próximos a la vivienda humana son los más riesgosos, no solo por el aporte de los triatominos al domicilio, sino por la movilización de estos insectos para alimentarse sobre personas que duermen cerca. En los triatominos de hábitat peridomiciliario más próximos a las viviendas se registró un aumento de la ingesta sobre humanos, mientras que en gallineros alejados a más de 12 metros de la vivienda no se detectaron en los triatominos ingestas sobre humanos De este modo, al evidenciarse la presencia materia fecal, mudas o huevos de los insectos, se procedió a desarmarlos con mucho cuidado, golpeando los objetos sobre una lona plástica blanca o una cubeta plástica blanca de 100 cm x 40 cm x 24 cm, dependiendo esto del tamaño de los objetos a examinar. Ambos recipientes se colocaron en el piso del lugar y los insectos que caían se capturaron con pinzas metálicas entomológicas. En cada sitio se recolectó la totalidad de los insectos hallados vivos, como así también los individuos hallados muertos e intactos. 38

56 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2k: Principales lugares donde se realizó la búsqueda de triatominos en peridomicilio. En todos los casos, se tratase de insectos de domicilio-peridomicilio o del ambiente silvestre, los triatominos se colocaron en recipientes plásticos individuales para evitar cualquier tipo de contaminación/alteración, se rotularon debidamente, asignando localidad, sitio específico de recolección, fecha y número de ejemplares. Finalmente fueron transportados al laboratorio para su posterior análisis. Triatominos colectados previamente Material conservado en la colección del Centro de Estudios Parasitológicos y de Vectores (CEPAVE) 39

57 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Se utilizaron para este trabajo diversas muestras debidamente conservadas, que se habían recolectado previamente al comienzo de esta tesis por nuestro grupo de trabajo, perteneciente al laboratorio de triatominos del CEPAVE. Estas muestras fueron tomadas de las provincias de Buenos Aires, Chaco, Formosa, La Rioja, Mendoza, San Luis, Santa Fe, Santiago del Estero y Tucumán. La metodología utilizada para la búsqueda de los triatominos fue la misma que se describió anteriormente. Material conservado en la colección de otros centros de investigación En varias oportunidades fueron recibidos triatominos pertenecientes a diferentes localidades de las provincias de Chaco y Córdoba. En el caso de los insectos provenientes de Chaco fueron enviados por Investigadores de la Unidad de Epidemiología Molecular, Instituto de Patología Experimental, Facultad de Ciencias de la Salud, Universidad Nacional de Salta, CONICET. Salta, Argentina y los insectos que provenían de Córdoba fueron enviados desde el Centro de Referencia de Vectores, Coordinación Nacional de Control de Vectores. Santa María de Punilla, Córdoba, Argentina MANTENIMIENTO EN EL LABORATORIO DE LOS TRIATOMINOS Los insectos que se colectaron en el campo, se trasladaron al Insectario del Centro de Estudios Parasitológicos y de Vectores, CEPAVE (UNLP-CCT- CONICET). Todos los triatominos se mantuvieron en un ambiente de 1,20m de ancho x 2,40m de largo x 3m de altura, con estanterías verticales donde se colocaron los recipientes plásticos con los insectos recolectados. Estos fueron preservados individualmente para evitar la posible transmisión entre los mismos, con una tela de nylon en la abertura del recipiente y con papeles doblados y colocados verticalmente en su interior. El insectario fue mantenido a 28 C +/- 1 C, 60% +/- 5% de humedad relativa y un fotoperíodo de 12:12 (L- O). El mantenimiento de las colonias de triatominos hasta realizar la extracción de materia fecal fue realizado mediante un alimentador artificial con sangre humana (obtenida del Instituto de Hemoterapia de la Provincia de Buenos Aires) diseñado en nuestro laboratorio. 40

58 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS TRABAJO DE LABORATORIO METODOLOGÍA PARA LA IDENTIFICACIÓN Y EXTRACCIÓN DE MATERIA FECAL DE LOS TRIATOMINOS Identificación Los ejemplares fueron identificados a nivel específico, utilizando las claves taxonómicas de Lent y Wigodzinsky (1979). Los triatominos fueron examinados individualmente, observándose a ojo desnudo y bajo microscopio estereoscópico para detectar algún tipo de alteración morfológica o parálisis en las extremidades. En los casos en los cuales se dificultó la determinación en sus estadios ninfales, los ejemplares fueron alimentados con un alimentador artificial hasta alcanzar el estado adulto. Métodos y procesamiento Los triatominos fueron procesados de diferente manera de acuerdo al ambiente: -T. infestans de domicilio o peridomicilio -Triatominos de ambientes silvestres Esto es debido al número de ejemplares que se colectaron en cada ambiente, en el caso de los hallados en los viajes. Generalmente las capturas de T. infestans en domicilio y peridomicilio fueron numerosas, mientras que la captura de ejemplares de triatominos silvestres en general varió entre 1, 2 o 3 individuos por muestra. Del mismo modo se evaluó a los insectos que habían sido capturados previamente como los recibidos de otros centros, aunque en estos casos se trató de triatominos de ambientes domiciliarios y peridomiciliarios. Extracción de materia fecal El procesamiento del material de todos los triatominos se inició inmovilizando al insecto con la ayuda de pinzas metálicas y presionando la región abdominal para obtener la materia fecal. Estas fueron resuspendidas en 200 µl de PBS y mantenidas en microtubos (Marti et al., 2008). Por lo expuesto anteriormente, los insectos se analizaron como se 41

59 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS detalla a continuación: -Triatominos silvestres: se extrajo la materia fecal y se analizaron individualmente; un ejemplar por tubo Eppendorf y así se prosiguió con su tratamiento. - T. infestans de domicilio y peridomicilio: se procedió de la misma manera que el punto anterior, con la diferencia que al encontrarnos con más cantidad de insectos, se realizaron pooles. Estos constaron de 10 a 15 individuos por tubo Eppendorf y así se prosiguió como en el caso de los tratados individualmente METODOLOGÍA PARA EL ANÁLISIS DE TRV Para la búsqueda y procesamiento del virus hallado en los triatominos de Argentina, se utilizaron las técnicas y metodologías descriptas por Adams y Bonami (1991); Evans y Shapiro (1997), Miller y Ball (1998), Marti (2005; 2008), Becnel (1997) y Rozas-Dennis et al., (2000). Elaboración del control positivo La purificación de partículas virales se realizó con ejemplares de la colonia de T. infestans infectada con TrV. El TrV purificado se utilizó como control positivo para todas las técnicas de diagnóstico. Desde el año 2002, se procedió a la instalación y mantenimiento de una colonia de T. infestans infectada con TrV en nuestro laboratorio del CEPAVE, de donde se tomaron distintas muestras de materia fecal para proceder a la purificación viral. Clarificado de los insectos Se utilizaron lotes de 30 insectos, los cuales fueron macerados en un mortero de cerámica con 10 ml de solución tamponada NMT (0,01M NaCl, 0,001M MgCl 2 y 0,04M Tris HCl ph 7,4). Luego el macerado se filtró a través de un tamiz de nylon. El clarificado se centrifugó en una ultracentrífuga Beckman rotor 40,2 Ti a rpm ( g) a 4 C durante 10 min. Purificación viral mediante gradientes de sacarosa La purificación se llevó a cabo según metodología descripta por Marti et al., El producto de la clarificación (sobrenadante) se centrifugó durante 3h en una ultracentrífuga Beckman rotor 70 Ti a rpm ( g) a 42

60 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS 4 C llegándose a obtener un pellet conteniendo restos celulares y TrV. El pellet se resuspendió en una solución tamponada NMT y se sembró en un gradiente continuo de sacarosa 10%-30% (P/V) preparado en la misma solución tamponada. El gradiente se centrifugó a rpm ( g) en un rotor Beckman SW 28.1 durante 3h a 4 C. Luego de la centrifugación se recolectaron del gradiente, fracciones de 2 ml aproximadamente, por medio de pipetas y luego se midió la absorbancia de cada fracción a 260 nm con un espectrofotómetro. El pico de la lectura a 260 nm correspondió a las partículas de TrV purificado y se utilizó para determinar la masa aproximada de virus purificado. Las fracciones seleccionadas se diluyeron en una solución tamponada salina NMT y se centrifugaron finalmente durante 2 hs a g, a 4 C en un rotor de 80 Ti Beckman. Los sedimentos obtenidos se resuspendieron en 1 ml de una solución tamponada TE (-Tris EDTA- 1mM EDTA, 10mM Tris-ClH ph 7,4). De esta manera, el virus purificado se fraccionó en alícuotas de 0,24 ml en tubos Eppendorf y se conservó a -20 C y a -70 C (Fig. 2l). Figura 2l: Detalle de los pasos de la purificación viral para obtención del control positivo. 43

61 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Técnica de electroforesis en SDS-PAGE para evaluación de partículas virales purificadas Para confirmar su identidad y grado de pureza, se procedió a analizar las proteínas estructurales a partir de las partículas virales purificadas en el paso previo por medio de la electroforesis en SDS-PAGE. Para esta técnica se utilizó una solución stock de 30-0,8% de acrilamida-bisacrilamida. Se utilizaron dos concentraciones para la preparación de los geles: 10% y 12,5%. Se empleó un sistema de tampón discontinuo que desencadena un gradiente de voltaje para lo que se utilizó una solución tamponada Tris-ClH ph 8,8 y 6,8 y una solución tamponada de reservorio ph 8, básicamente de acuerdo al método descrito por Laemmli (1970). Las cantidades de persulfato de amonio (APS), tetra metil etilen diamina (TEMED) y dodecil sulfato de sodio (SDS), se ajustaron para el tiempo óptimo de polimerización según las concentraciones de acril-bisacrilamida: Gel de corrida 10% 12,5% Acril - bisacrilamida (30-0,8%) 10 ml 12,5 ml Tris ClH (0,4M) ph 8,8 7,4ml 7,4 ml Agua destilada 12 ml 9,4 ml TEMED 0,02 ml 0,02 ml SDS (10%) 0,3 ml 0,3 ml APS (1%) 0,2 ml 0,2 ml El gel concentrador o stacking, donde se sembró la muestra, fue utilizado al 5% con las siguientes composiciones: Acril- Bisacrilamida (30-0,8%) Tris ClH (0,5M) ph 6,8 Agua destilada TEMED SDS (10%) APS (1%) 0,66 ml 1,25 ml 3 ml 0,005 ml 0,05 ml 0,075 ml 44

62 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Las muestras fueron procesadas en tampón de muestra para trabajar en condiciones no reductoras (NR): Tampón de muestra Tris ClH (0,5M) ph 6,8 SDS (10%) Glicerol Agua destilada Azul de bromofenol NR 0,250 ml 0,400 ml 0,400 ml 0,950 ml 0,020 ml Para la preparación de las muestras se colocaron aproximadamente 10 µg de TrV purificado y 30 µl de tampón muestra en un tubo Eppendorf que se colocó a baño maría (100ºC) durante 5 min (Muscio et al. 1988). Como marcador de peso molecular se utilizó un producto comercial (Pharmacia) que fue resuspendido en el mismo tampón y que da seis bandas diferentes de pesos moleculares: 94 kd, 67 kd, 43 kd, 30 kd, 20,1 kd y 14,4 kd. Se sembraron 30 µl de muestra y 5 µl de marcador de peso molecular (PM) en las placas de 90 x 100 x 1 mm. Las condiciones de corrida se estandarizaron a 100V durante 2h por placa y el buffer de corrida utilizado fue: Tris 25 mm, glicina 191 mm, SDS 1%. La tinción de los geles fue realizada con azul brillante de Coomasie que detecta 0,2 a 1 µg de proteína (Sambrook et al., 1989). Esta solución colorante se dejó actuar 4 horas a temperatura ambiente (TA); los geles se decoloraron en agitación durante 12 horas como mínimo en una solución metanol ácido (30% metanol, 10% ácido acético glacial). Las soluciones stock para preparar los geles de acrilamida fueron las siguientes: 1. Solución Acrilamida-Bisacrilamida: Acrilamida 30g; Bis acrilamida 0,8g; Agua CSP 100ml. 2. Buffer Tris-HCl 1,5M ph 8,8: Tris 18,15g; HCl para llevar a ph 8,8; Agua CSP 100ml. 3. Buffer Tris-HCl 0,5M ph 6,8: Tris 3g; HCl para llevar a ph 6,8; Agua CSP 100ml. 4. Persulfato de Amonio al 1%: 0,05g de APS en 0,5ml de agua. 45

63 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS 5. Buffer de corrida 10x: Tris 30,2g; Glicina 144g; Agua CSP 1000ml. 6. Buffer de corrida 1x: 100ml buffer de corrida 10x mas 10ml SDS 10%, Agua CSP 1000ml. 7. Buffer de carga: Tris-HCl 0,5M ph 6,6 (250ul); SDS 10% (400ul); Glicerol (400ul); Azul de Bromofenol 0,1% p/v (20ul); Agua (850ul) 8. Solución de teñido: Azul Brillante de Coomasie 0,1g; Metanol 41,7ml; Acido acético glacial 16,6ml; Agua 41,7ml. 9. Solución de desteñido: Metanol 300ml; Acido acético 100ml; Agua 600ml. Detección, aislamiento e identificación Extracción de ARN La técnica de extracción del ARN se llevó a cabo a partir de la materia fecal de los triatominos analizados con el método de extracción fenólica con Trizol (Invitrogen). Se mezclaron 50 µl de solución de materia fecal con 300 µl de Trizol. Se vortereó 15 seg y se dejó incubando 5 min. Luego se centrifugaron las muestras a rpm durante 2 min a 4 C. Posteriormente se adicionaron 60 µl de cloroformo y se vortereó 15 seg. Se dejó incubar a TA por 2 a 3 min observándose dos fases. Se centrifugaron las muestras a rpm 15 min a 4 C y se trasvasó la fase acuosa superior (aproximadamente 200 µl) a un tubo de microcentrífuga nuevo con 150 µl de isopropanol. Se invirtió cinco veces y se dejó incubar a TA 10 min. Se centrifugó a rpm 10 min a 4 C y se descartó el sobrenadante con cuidado. Se lavó el precipitado con 300 µl de etanol 70%, se procedió a centrifugar a rpm, 5 min a 4 C y se descartó el alcohol. Este procedimiento se repitió dos veces. Luego se centrifugó 15 seg y el pellet se desecó aproximadamente 10 min a 37 C. Se resuspendió el ARN viral en 15 µl de agua libre de nucleasas. Se utilizaron controles positivos a partir del virus purificado preparado anteriormente. Técnica de RT- PCR Se define a esta técnica, como la amplificación enzimática selectiva de 46

64 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS las secuencias de ADN o ARN, flanqueadas por los dos oligos cebadores o primers que hibridan con las cadenas opuestas de la secuencia de interés. El acido nucleico presente en la muestra se desnaturaliza a altas temperaturas y luego los cebadores se hibridan a las cadenas en forma complementaria, produciendo la síntesis de nuevas cadenas complementarias al ADN por la acción de la enzima polimerasa. Durante cada ciclo programado, cada cadena de ADN sirve de molde al ciclo siguiente, de manera de obtener grandes cantidades de ADN que se visualiza en geles. En el caso de TrV, al ser virus ARN, se realizó previamente una transcripción reversa. Se utilizo la técnica de RT-PCR en un solo paso. Para la obtención del ADNc se procedió a la utilización del Kit One Step RT-PCR (QIAGEN, USA). El ADNc obtenido se almacenó a -20 C hasta su empleo. Los primers utilizados fueron los descriptos por el Dr. Marti (Marti et al., 2008): TrV 1 a 5 TCAAAACTAACTATCATTCTGG 3 (nt ) TrV 1 b 5 TTCAGCCTTATTCCCCCCC 3 (nt ) Para amplificar el fragmento de interés, se llevaron a cabo cada una de las reacciones a un volumen final de 20 µl. Los volúmenes y concentraciones finales de los reactivos usados se indican en la siguiente tabla para un total de muestras. La reacción consistió en 5 µl de cada ARN y 15 µl de la mezcla de RT-PCR: REACTIVO CANTIDADES (ul) Agua libre de nucleasas 150 Buffer de RT-PCR 50 Mezcla de dntp 10 Cebador 1 15 Cebador 1b 15 Mezcla de enzimas de RT-PCR 7 RNAsin 1 Las reacciones de PCR se realizaron en equipo Eppendorf Mastercycler Gradient. El ciclado utilizado fue el propuesto por Marti (Marti et al., 2008) y 47

65 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS consitió en un primer paso de retrotranscripción a partir del ARN, de 35 min a 50 C; un paso de desnaturalización de 15 min a 95 C y luego 35 ciclos como se indica a continuación: Desnaturalización: 50 seg a 94 C Hibridación: 50 seg a 48 C Elongación o extensión: 1 min 30 seg a 72 C Por último se realizó una extensión final de 10 min a 72 C. Las reacciones de PCR se visualizaron en geles de agarosa al 1,5 %, utilizando TBE 1X (Tris Base 89 mm, Acido Bórico 89 mm y 2 mm EDTA) como buffer de corrida. Como marcador de pares de bases se empleó el 100bp DNA Ladder (Promega). Los geles se sometieron a un voltaje de 100V por un período de tiempo acorde al fragmento amplificado y utilizando para ello el frente de corrida presente en el buffer de carga. Los geles se tiñeron con Bromuro de Etidio (0,5 µg/ml) luego de la corrida y se visualizó el resultado bajo transiluminador de luz UV. Diseño de primers Con el objetivo de secuenciar el ORF2 completo de las materias fecales positivas a la RT-PCR diagnóstica y evaluar diferencias o similitudes de secuencias de TrV entre especies de triatominos, se diseñaron 3 nuevos pares de primers específicos para los genes que codifican para las proteínas de la cápside: VP2 a VP4; VP4 a VP3 y VP1 del ORF2. La primer secuencia de primers abarca parte de la Región Intergénica (RI) y la última abarca parte de la región 3. Se realizó un diseño preliminar utilizando el programa DNAman (Lynnon Biosoft. Copyright ). Los diseños de los cebadores se basaron en la secuencia de la cepa de referencia AF178440, disponible en el GenBank (Czibener et al., 2000). Como molde se utlizó ARN de virus purificado perteneciente a la cepa proveniente del insectario del CEPAVE, TIN1 (HM044313), con la metodología descripta en el apartado Los parámetros de diseño de cada uno de los cebadores fueron los siguientes: 1. Longitud entre 18 y 24 pares de bases (pb). 48

66 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS 2. Contenido de G+C 60%. 3. Temperatura de hibridación 54ºC. 4. Alta compatibilidad entre el par de cebadores y entre el mismo cebador. De todos los resultados obtenidos con el programa DNAman, se escogió el par de cebadores que permitiera obtener cada uno de los genes de interés. Purificación y cuantificación Se purificaron los fragmentos amplificados por PCR empleando el kit comercial Wizard SV Gel and PCR Clean-Up System (Promega), y/o kit de purificación AxyPrep DNA Gel Extraction Kit (Axygen Biosciences, China) siguiendo los protocolos de los fabricantes. Otra variante utilizada que permitió una mejor recuperación de los productos de PCR fue el uso de Polietilenglicol y Acetato de sodio como precipitantes (50-50). Los productos así purificados fueron cuantificados en geles de agarosa empleando el MassRuler DNA Ladder, low range, Reddy-to-use (Fermentas) como patrón de referencia. Cada una de las bandas de este marcador posee una cantidad de ADN cuantificada y tabulada, por lo que la cuantificación de los productos de interés fue realizada en base a la comparación de intensidad de la banda incógnita con las bandas presentes en el marcador. La purificación de los productos de PCR de cada sector amplificado, se realizó con el objeto de realizar la secuenciación directa o bien en algunos casos, para ser clonados en vectores bacterianos y posteriormente ser secuenciados. En este último caso, se logra obtener mayor cantidad de producto para su secuencia, pero no todos los secuenciadores aceptan productos de plásmidos. Por esta razón, las primeras secuencias de TrV fueron clonadas y las últimas solo secuenciadas en forma directa. Clonado del producto de PCR en vector bacteriano Los productos de PCR fueron clonados al vector de clonado pgem-t Easy Vector Systems (Promega) siguiendo los manuales de procedimiento del fabricante. Para el clonado se utilizó una proporción molar de 3:1 de inserto: vector. Teniendo en cuenta un tamaño de 832 pb teóricas y una concentración 49

67 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS provista por el fabricante de 50 ng/ml del vector pgem-t, se empleó la siguiente fórmula para el cálculo de la masa de inserto a utilizar: [( ngvector x Kbinserto ) Kbvector ] x proporcion molar (inserto vector) = nginserto Con la concentracion determinada de la cantidad de inserto a utilizar, se procedió a la preparación de la siguiente mezcla de ligación: REACTIVO CANTIDADES (ul) Buffer 2X Ligación Rápida de la T4 ADN Ligasa 5 Vector pgem-t Easy (50ng) 1 Producto de PCR X 4 ADN Ligasa (3U/ul) 1 Agua libre de nucleasas: CSP 10 La reacción se mezcló por pipeteo. De acuerdo a las recomendaciones del fabricante, se incubó 1 h a TA y toda la noche a 4ºC. Competencia de las células Con el objetivo de obtener células permeables al vector de clonado se realizó la competencia de las mismas. Se utilizaron las células Top10. Para la competencia de las células se plaquearon las mismas por el método de estría por agotamiento utilizando placas LB con 25 ul/ml de Kanamicina. Una colonia aislada se picó y cultivó toda la noche en medio LB con antibiótico. A partir de este cultivo se realizó una dilución 1/100 y se incubó a 37ºC hasta obtener la fase log de crecimiento (DO=0,6). En ese momento se centrifugó en cultivo a 3000 rpm por 5 min a 4ºC y se descartó el sobrenadante. Se agregaron 2ml de MgCl2 100mM y se centrifugó en las mismas condiciones. Se descartó el sobrenadante y se agregó 1ml de MgCl2 100mM incubando 15 min en hielo. La mezcla se centrifugó, descartó el sobrenadante y agregó 1ml de CaCl2 100mM. Se incubaron las células 15 min en hielo y nuevamente se centrifugó descartando el sobrenadante. Se resuspendieron las células en una solución mixta de 1ml de MgCl2 100mM y 1 ml de CaCl2 100mM y se incubaron 15 min en hielo. Se añadió 20% de glicerol shock a las células, fraccionando 100ul de las células competentes en tubos de microcentrífuga los 50

68 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS cuales se almacenaron a -70ºC hasta su utilización. Transformación Se transformaron células competentes Top10 con 3 µl del producto de ligación. Se mezcló por inversión y se incubaron en hielo durante 10 min. Luego, 90 seg a 42ºC a baño maría y por último se incubó 10 min en hielo nuevamente. Luego se agregaron 900ul de medio SOC y se incubó el tubo con agitación (150 rpm) durante una hora a 37ºC. Finalizada la incubación, se sembraron 100 µl de cada transformación en placas de agar Luria Bertani (LB) (Triptona 10g/l; Extracto de levadura 5g/l; NaCl 5g/l; Agar 15g/l), con el agregado de 100 µg/ml de Ampicilina, 0,5mM isopropil-β-d-tiogalactopiranosido (IPTG) y 80ug/ml de X-Gal. Las placas se incubaron 24 horas a 37ºC y se seleccionaron las colonias blancas para su posterior evaluación. Aislamiento del plásmido con el fragmento de interés: minipreps La miniprep es la extracción de ADN de naturaleza plasmídica de un cultivo bacteriano. Para ello, a partir de cada colonia blanca aislada se hizo crecer un cultivo líquido en medio LB con 100 µg/ml de Ampicilina en agitación durante toda la noche a 37ºC. El cultivo se centrifugó a 1500 rpm durante 5 min. El sobrenadante se descartó y el precipitado bacteriano fue resuspendido en 100 µl de solución P1, agitando vigorosamente en vórtex. Se agregaron 200 µl de solución P2, se mezcló por inversión y luego de un reposo en hielo de 5 min, se adicionaron 150 µl de solución P3 fría. Se mezcló por inversión y se dejó en hielo por 5 min. Se centrifugó a rpm a 4ºC durante 12 min y el sobrenadante obtenido fue transferido a un tubo de microcentrífuga. Se adicionaron 1,5 volúmenes de isopropanol frío y se centrifugó a rpm durante 15 min a 4ºC. Se retiró el sobrenadante y se lavó el precipitado con un volumen igual de etanol 70%, se centrifugó por 5 min y se descartó el sobrenadante. Se desecó y por último se resuspendió el ADN plasmídico en µl de agua estéril libre de nucleasas (Promega). Se utilizó también el kit comercial Wizard Plus SV Minipreps DNA Purification System- (Promega, Madison, Wiscosin. USA) siguiendo el protocolo del fabricante. Las soluciones empleadas en esta técnica fueron las siguientes: 51

69 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS SOLUCIÓN P1: 50 mm Tris/HCl; 10 mm EDTA ph= 8.0. SOLUCIÓN P2: 0,2 M NaOH; 1% SDS. Esta solución se prepara en el momento de uso a partir de soluciones madre de 0,4M NaOH y 2% SDS. SOLUCIÓN P3: 3M de Acetato de Potasio (Kac) ph= 4,8. PCR con primers del vector de clonado Luego de realizar minipreps se realizaron reacciones de PCR para verificar la correcta inserción del fragmento de interés en el vector de clonado, utilizando para ello los siguientes primers: T7 5 TAA TAC GAC TCA CTA TAG G 3 SP6 5 GAT TTA GGT GAC ACT ATA G 3 siguientes: Las cantidades utilizadas para la realizacion de la PCR fueron las REACTIVO CANTIDAD (ul) Master Mix 10 Cebador 0,5 Cebador 0,5 Agua 7 Muestras 2 El programa utilizado fue el que se detalla a continuación: TEMPERATURA TIEMPO (min) * 55 1* 72 1* *25 ciclos 52

70 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Glicerol stock Todas las colonias de interés en este trabajo se almacenaron en glicerol. Partes iguales del cultivo líquido de la colonia de interés se mezclaron con una solución estéril de glicerol al 80%. Se agitó en vórtex y se guardó a -70ºC hasta su posterior empleo. Para la reactivación de la colonia almacenada, se tomó un inóculo del glicerol stock con ansa anillo y se resuspendió en medio de crecimiento con los antibióticos adecuados. Secuenciación, alineamiento y arboles filogenéticos Secuenciacion de los productos de PCR-secuenciación del producto del clonado Los productos clonados en vectores rápidos (pgem-t) o los productos de PCR se purificaron como se describió en párrafos anteriores y se enviaron a secuenciar: se llevó a cabo por el método de Dye-Terminator en el IGEVET, Facultad de Ciencias Veterinarias, de la Universidad Nacional de La Plata y en el Unidad de Genómica, Instituto de Biotecnología, CICVyA - CNIA INTA, respectivamente. Alineamientos de las secuencias obtenidas La identidad de secuencias se analizó por comparación de genes conocidos de las secuencias públicas de las bases de datos disponibles (NCBI). Las secuencias fueron analizadas utilizando la versión de software 5 BioEdit (Hall, 1999). Se utilizó la secuencia de referencia AF y la cepa TIN1. El análisis de homologías se realizó con el programa BLASTN (BLASTN. National Center for Biotechnology Information). Las secuencias fueron alineadas con el programa MEGA Version 4.0 usando el algoritmo ClustalW. Las distancias de las secuencias fueron calculadas con el programa DNAstar (Tamura et al., 2007). Los árboles filogenéticos de las secuencias de las proteínas de la cápside fueron construídos por el método de neighbor-joining (NJ) utilizando el programa MEGA con un bootstrap de 1000 réplicas. Las distancias se calcularon con el método de Maximum Composite Likelihood (Tamura et al., 2007). 53

71 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Microscopía electrónica de transmisión (MET) Una gota de solución de TrV purificado para su uso como control positivo y una gota de cada materia fecal positiva a TrV por RT-PCR fueron corroboradas por ME. Para aquellos resultados negativos por RT-PCR, se seleccionaron al azar algunas para su observación. Se colocaron en una grilla con membrana de colodión y se la dejo absorber durante 7 min, retirando el excedente. A continuación, una gota de acido fosfotúngstico fue colocada sobre la grilla e incubada durante 40 seg. Finalmente, la grilla fue secada unos minutos y observada en el microscopio electrónico. El microscopio electrónico utilizado pertenece al Servicio de Microscopia Electrónica de la Facultad de Ciencias Veterinarias, de la Universidad Nacional de La Plata (microscopio electrónico de transmisión Jeol JME 1200 EX II) RESULTADOS Durante este trabajo de tesis, se efectuaron recolecciones de triatominos en 10 provincias de la Argentina desde agosto de 2008 hasta febrero de 2011 (Fig. 2m). Las colectas se realizaron en los ambientes silvestres, de domicilio y peridomicilio. Asimismo fueron analizados triatominos provenientes de otros centros de referencia como así también fueron considerados insectos de nuestro laboratorio debidamente conservados. 54

72 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2m: Mapa de Argentina: en color gris las provincias analizadas. A continuación se especifican los triatominos estudiados, puntualizando número de ejemplares, especie y provincia. En el caso particular de aquellos recogidos durante el muestreo realizado en el período de beca, se adicionan tablas de coordenadas de los lugares de búsqueda TRIATOMINOS SILVESTRES Se recolectaron 125 muestras de un total de 606 insectos de cinco localidades de la provincia de Chaco y dos localidades de la provincia de La 55

73 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Rioja. En total para ambas provincias se colectaron diez especies (ver anexo tablas. Tablas A, B y C, páginas 74, 75 y 76) TRIATOMINOS EN DOMICILIO Y PERIDOMICILIO Triatominos colectados durante este período de trabajo Se recolectaron 35 muestras de un total de 590 triatominos pertenecientes a tres especies de las provincias de Chaco, La Rioja, Santa Fe y Santiago del Estero (ver anexo tablas. Tabla D, página 77). Triatominos colectados previamente Material conservado en la colección del Centro de Estudios Parasitológicos y de Vectores (CEPAVE) Se analizaron 27 muestras de un total de 401 triatominos (399 T. infestans y 2 T. guasayana), pertenecientes a las provincias de Buenos Aires, Chaco, Formosa, La Rioja, Mendoza, San Luis, Santa Fe, Santiago del Estero y Tucumán (ver anexo tablas. Tabla E, página 78). Material conservado en la colección de otros centros de investigación Se trabajó con 6 muestras de un total de 120 T. infestans pertenecientes a las provincias de Córdoba y Chaco (ver anexo tablas: Tabla F, página 79). En las siguientes figuras pueden observarse los distintos ambientes estudiados (Figs. 2n; 2o; 2p). 56

74 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2n: Captura de triatominos en peridomicilio. 57

75 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2o: Captura de triatominos en cardones secos y nidos de aves. Figura 2p: Captura de triatominos utilizando Trampas Noireau. Se analizaron un total de 1717 triatominos pertenecientes a 10 especies: T. infestans, T. guasayana, T. delpontei, T. breyeri, T. eraturysiforme, T. sordida, T. platensis, T. garciabesi, Panstrongylus guentheri y Psammolestes coreodes. Del total de insectos analizados, 606 (35, 29%), fueron de ambiente silvestre, mientras que 6,23% (107 triatominos) de 58

76 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS domicilio y 58, 47% de peridomicilio (1004 triatominos). Los resultados positivos por RT-PCR fueron obtenidos de 29 muestras de cuales, 16 fueron de ambiente peridomiciliario y 13 de colectas de insectos silvestres (Tabla G y Fig. 2q). 59

77 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS MUESTRA PROVINCIA AMBIENTE ESPECIE 8 Santa Fe Peridomicilio T. infestans 9 La Rioja Peridomicilio T. infestans 12 San Luis Peridomicilio T. infestans 14 Mendoza Peridomicilio T. infestans 15 Tucumán Peridomicilio T. infestans 18 Tucumán Peridomicilio T. infestans 20 Tucumán Peridomicilio T. infestans 22 La Rioja Peridomicilio T. infestans 23 La Rioja Peridomicilio T. infestans 24 La Rioja Peridomicilio T. infestans 26 Santiago del Estero Peridomicilio T. infestans 27 Santiago del Estero Peridomicilio T. infestans 5 Chaco Peridomicilio T. infestans 33 Chaco Peridomicilio T. delpontei 34 Chaco Peridomicilio T. infestans 31 Chaco Peridomicilio T. infestans 124 Chaco Silvestre T. guasayana 7 Chaco Silvestre T. delpontei 33 Chaco Silvestre T. infestans 9 Chaco Silvestre T. infestans 93 Chaco Silvestre T. platensis 31 Chaco Silvestre P. coreodes 48 Chaco Silvestre P. coreodes 49 Chaco Silvestre P. coreodes 125 Chaco Silvestre P. coreodes 98 La Rioja Silvestre T. delpontei 102 La Rioja Silvestre T. breyeri 97 La Rioja Silvestre T. guasayana 104 La Rioja Silvestre T. guasayana Tabla G: Muestras positivas a TrV mostrando especie, provincia y ambiente donde se halló. 60

78 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2q: Mapa de Argentina detallando en color las provincias donde se encontraron muestras positivas a TrV. De las 29 muestras positivas, 15 fueron secuenciadas, obteniendo secuencias no solo de T. infestans, sino también de T. delpontei y Ps. coreodes. Los ambientes donde se ha encontrado TrV fue en gran parte en peridomicilio y el resto en el ambiente silvestre (Tabla H y Fig. 2r). La cepa TIN1 fue secuenciada durante el desarrollo de esta tesis (en la tabla H es la muestra CEPAVE). 61

79 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS MUESTRA ESPECIE NOMENCLATURA PRIMERS VP2/VP4 VP4/VP3 VP1 8(CP) T. infestans TIN3 No No No 12(CD) T. infestans TIN9 No No No 14(CP) T. infestans TIN5 No No No 15(CP) T. infestans TIN4 Si Si No 18(CP) T. infestans TIN10 No No No 20(CP) T. infestans TIN8 Si No No 22(CP) T. infestans TIN11 No No No 5(CP) T. infestans TIN6 Si Si No 31(P) T. infestans TIN7 No No No 7(S) T. delpontei TDE1* No No No 33(P) T. delpontei TDE2 No No No 9(S) T. infestans TIN2* No No No 48(S) Ps. coreodes PCO1* No No No 26(CP) T. infestans TIN12 No Si Si 9(CP) T. infestans TIN13 Si Si No CEPAVE T. infestans TIN1* Si Si No Tabla H: Muestras secuenciadas mostrando especie, y oligonucleótidos utilizados en cada caso (No/Si hace referencia a si hubo producto positivo para poder secuenciar). La muestra TIN1 corresponde al insectario del CEPAVE (T. infestans= Córdoba- Peridomicilio). (Acceso al GenBank: TIN1: HMO44313; PCO1:HM044315; TIN2:HM044314; TDE1:HM044312). Los datos de procedencia y hábitat se detallan en la Tabla G. Muestras (S): silvestre; (D): domicilio; (P): peridomicilio; (C): CEPAVE. 62

80 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2r: Especies representativas donde fue hallado TrV. De izquierda a derecha: Triatoma infestans, hallada en nido de furnaridos; Triatoma delpontei hallada en nidos de Psitacidos; Psamolestes coreodes encontrada en nido de furnáridos CONTROL POSITIVO DE TrV El estudio de las proteínas estructurales presentes en las partículas virales mediante electroforesis en SDS-PAGE dió como resultado la separación en los geles de cuatro bandas correspondientes a 3 proteínas constitutivas del virus; VP2, VP3 y VP1 con peso molecular de acuerdo a la movilidad electroforética de aproximadamente 29, 32 y 30 Kda respectivamente. También aparece una tenue banda (VP0) de peso molecular superior a las tres proteínas principalmente visibles (VP1 VP3) en el gel (Fig. 2s). 63

81 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS VP0 VP3+VP1 VP2 Figura 2s: Técnica de electroforesis en SDS-PAGE para evaluación de partículas virales purificadas. 1: marcador de peso molecular (LMW). 2-10: partículas virales purificadas; se marcan las proteínas de las partículas de TrV purificadas DETECCION, AISLAMIENTO E IDENTIFICACION Técnica de RT-PCR Los resultados de la detección por RT-PCR de TrV de los insectos analizados dió positiva en los casos anteriormente mencionados. La visualización del mismo se llevó a cabo en geles de agarosa. En la siguiente figura se muestra en detalle una PCR positiva para el virus (Fig. 2t). 64

82 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2t: Gel de agarosa mostrando el resultado de una RT-PCR: 1: marcador de peso molecular; 2, 3 y 4: muestra de materia fecal positiva; 5 y 6: muestras que resultaron negativas al virus; 7: control negativo y 8: TrV como control positivo Purificación y cuantificación Los fragmentos amplificados por PCR se purificaron y se cuantificaron en geles de agarosa empleando el MassRuler como patrón de referencia. La purificación de los productos de PCR de cada sector amplificado incognita se comparó en base a la intensidad de la banda del marcador (Fig. 2u). 65

83 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Figura 2u: Purificación y cuantificación en geles de agarosa: 1: marcador de peso molecular. 2-5: patrón de bandas purificadas Secuenciación, alineamiento y árboles filogenéticos Como se mencionó en el apartado anterior, una vez obtenidos los resultados positivos, previa purificación y cuantificación, las muestras se remitieron a secuenciar. Cabe recordar que el genoma de TrV posee dos marcos abiertos de lectura (ORF1 y ORF2). Se describe al ORF1 entre los nucleótidos (nt) 549 a 5936 y al ORF2, entre los nt 6109 a Tomando como base la única secuencia completa de TrV de la base de datos del GenBank (AF178440) se diseñaron los distintos pares de primers (indicados en el genoma completo). Las distintas subregiones quedan demostradas con los siguientes colores: VP2 ---VP4---VP3-----VP1 66

84 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Genoma completo de TrV (AF178440): TTGTGAAAAAGTGGAACAACGACCTGTGGTAAAATGTGAATCTTGTGAAAAGGATACACAAAGACCCA CAGTACGTTGTGAAACTTCTACATTAGATATGAAAGTTGATAACCAACCTTGTGATGAATTTCTTACAA AATCTCAAGGAGTTTTAGATCTGAATGCATCAGAAGTTTTAGGAAAAATAACGAAGAAGAATCTCTAT GCGATGTATATGCCTGGTGTTAGGTTGGGACATGCTCTTTTTATTAAAGGGTGTGTTGCAGCCTTTCCCA CGCATTTTATAGCTGCAATGAAGTTAAGAATCTCTAAAAATCCTGAAGCTGAAGTTTGTTTTAAATCTCC ATTTGTTAATCGTCCTGTTTGGAAGATGTTAGCTAAAGATCTGATTAATTTAAGCAAACCTTTTTCCTAT AAAACAAATTTACCTTGTGATCTTACATTAGCACCTATTAGGGTAGCATGGTCTCATAATGATATTACC GACCTATTTGTTTCGGCAAGTGAGGTTAGTAGAGTTATAGAATCTCCTGCTGTGTTACCTCTAATTATGT GTGATAATGGAAAGGATCCTGGATTTGGTGTAATAAAATTCACTAGTGCAGGATCTAGATTACAAGAG AAGACTGATTTAATTTATAAGGGACCTGATTCTCAAAATATATACTTAAGATCTGCATGGGAGTATTCA CTTGATACTCAATCTGGTGATTGTGGTGCTCCTTTAATTTTAAGAAACCCTATGTGTAGAGGAAAGATCT GTGGAATACATGTAGCTGGTCTACCAACTGGTGGACTCGGCTATGCTGTTCCAATTACAAAGGAATTTA TTCTTGATTGTTTAAGTTCCTTTGCAAAACATGATCTGACCACTATATGCAATGTACCTGAAATATCTCA ATCTGGAGGAGTTAGTCAACTACCTCTCAATGAACCAATAACTTGGAATGATAATTTATCTATTCCTGG TGAATTTGGTTTAGTTGGGAAGGCAAGAGCTATTCCTTCACCTAGCAAATCTCAAATTACTGAATCTCT ATCTCATGGAGTAATAGCCCCGGTAAGAACTAGGACTACGCTCCTTTCTCCAATAAAGACTGATTCTGG GCCTTGGAATCCTATGCATGAGCGTATGCGAAAGTATGGGAGACCATTGACTGCTTTGGATGAAGAGTT AGTTTCTACTTGTGGGGCTGCTCTTCTAAATGACCTTCGCTCTACTTTGGCTCGTCGCAAGATTGATTAT ACAAATATTCGGTCTTGTTACGATTTTCAGACGGCTATGAGTGGTATTGATGGGGATGAAACTATCAAT TCTATAAAACGTAAATCTTCGCCAGGTTTCCCTTGGGTTTTTAAAACTTCTAGTGGAACTGGTAAGAAA CAGATTTTTGGAAATGATGGTGAATTCCTATTTGATACTCCTTTGGCTGTGGAATTAGAAGAAAAAGTT AAGGAGGTGATAGATCTTGCGAAGCAAGGCGTGAGGTATTCTCATGTTTTTGTTGATGCATTAAAAGAT GAAAGGAAACCGAGAGAGAAAGCTCATAAAACAAGAGCTTTTTCAGGATGTCCTTTGGAGTACCTTGC GGTATGTAAGATGTATTTTCAGGGTATCGTCTCGGTATTGACCAAATGCAAAAACGAAACGCATATTAG TGTAGGAACTAATGTGTATAGTAAAGATTGGGATTTTATGGCTAGATATCTTAAATCCAAGTCTGATGG TTTTGTAGCAGGTGATTTTGAGGGATTTGATTCCTCTCAATTGGTGCCTATACTACGAGAAATTGGAAAT GTTTTTAATGGTATTGCCAGGCAATTTCCCGATTGGAAGCCAGAAGATGATGAAGTCAGATTAGTTTTA CTTCAAAGTTTATGGCATTCTATTCACATTAATGGTGGAGATGTTGTAATGTGGGGTCATGCATTGCCTT CTGGGCATTATTTGACCGCTCCTTATAACTCTCTTTATGCTACTATGCTTTTCTCAATGGCCTTTGTTATT TTGTCTCGCAGGAACGGTACAAGAATGGGCCCTTCTATGCTTGCATCTAAATTCTTTAAAGAATTTGGTT TTGTGGCATATGGAGATGACCATATTTGTGCCGTTCCGAAACGTTATCAATCCTTTTTCAATCAAATGAC TTTGGAAAAAGTATTTCTTGAATTAGGAATTGGTTACACAACAGAGGATAAGCGTGAGATTGATGTCCC AATTCGTTCTTTAGATGAAATTGCTTATTTAAAAAGAAGTTTCGTTTTAGACGAAGAAAGACAACAATG GATCGCTCCTCTGACCCTGGATACTGTATTGGAAACGCCAAGTTGGATTCATCGTTGTGATGATCCGAT AGAAGCAACTGTTTCTAATATAGAATTCGCATTACGTGAGTTGTCTCTCCATTCGAAACAAGAGTGGGA GAAGTATGCTCCTGTAATGTTAAGTGAAGTAACGAGATTGGGTAGGACTACTATATTTCATGATTGGGC AGATACTAGGGCTTTTGTACTAGATGATCTGTCTCCAGATGAGATATGGAATCCTACGGACTTGACTAT GTGATCTTGCTTTCGTAATAAAATTCTGTACATAAAAGTCGAAAGTATTGCTATAGTTAAGGTTGCGC TTGCCTATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAAT TTTCCTATACCTCGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACA TGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAA ATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACTTTTGTACATGATAATCCGATAATCACTGAG 67

85 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS CAACTAATTGGAGATAGTCCACAGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCT ATTATTGATTTCTTAGAAAGACCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATA AAGAAATCTTTTCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTT TACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTG GTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAACATGTTAAGTTTTGATGTTTC TAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGCAAGGAAACAGAAGTCTTATTGAAGATTCC TTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGT GTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATC AAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT TTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTAT TGGAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTT TCCAAACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTG ATGGTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTG CCGGAACATCTTCTGATGAGGTGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAA ATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAAT CACGTTACAGTTGTTGATGCTCCAGGGCAGCCTACTTTGCTAGCTTATGCCACAGGATTTTTCAAATATT GGAGAGGTGGTCTCGTTTATACGTTTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTA CATTTCATCCCTTTGTTGGGTATGATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACG TCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTAC TCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTAGAGA CTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTTCTGCTTTAACTCCT CTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAGGTTAAAGCCTCAGATGATTT TGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAGAGAGGCCTTCATTAGAT GGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGG GGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAG AATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTTCTGA CGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGACA AACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTA CGCATTTTATAGGGGGGGAATAAGGCTGAAGATTGTTCCCGGTGTTGCCGATCAACCTAAACCTCTGGT AGAAGTGGCTTTGTTTACTATGCAGGATCAAGGCTATATCATTAAAGCTAATGATTATAGCACTGATTT CTGCTCGTCGAATATATATGAAAATTTTGTTACTAAAGGAATAGCAGAGGTACAAACTCCTTATTATTC AAGGGTTAATACCTCTGTTGTTTCTGCTCCTGTTCTTTATAACGCAGGTAATATTTCTCCACTAATGCCG AATGTTATGTATAAGATAACATCAAATTCATCAAACATTCTGCTTGGTCATTCTGCTGCTGATGATTTCC GTTTTGGATTTCTCTTGGGAGCTCCATTAGCTATTTCAGCTACGGCTCTTAGAGATAACTTTACGGGATC CTCTGCTACAGTTTCTCTTCCTACCTTCTCAAATTTTTATCTATCTTCGACTTCAGAGTCCACTACTTAGA GGCTAGTGGTTGTTCGTACATTGGGTCAAGACTCAGTCTTGTTTTTCCGTATGTAAATATAAATATACAT TCATTTATTGTAAATAATTATATATATATAATTTTGTTTGTTTGTAAATAATGTGCTTTTATATGTTTGTG TCTGTGTCTTTCAGGTTTCTTCTTGATTCTTCCTGAGGGTACTAATCGAATCATGTATTTTGTTTTATTAT TATATACGTTTTTGTTCGCTTTGTCCGTTCAGTGGACCAAGTTTTGGCAATAGCTGACACTTGTTTCAC AGCTTCTTTCTGC 68

86 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS Así se realizo la traducción del ORF2. El orden de las proteínas se indica a continuación con los colores correspondientes: VP2 ---VP4---VP3-----VP1 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVHDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGR LVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVY APLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIGKYA DPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSSDEVA LEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRF VKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPV DSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSW RYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKP LVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPN VMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLSSTSESTT Para la amplificación del ORF2 se tomaron regiones previas y posteriores al mismo, esto significa la región intergénica y la región 3, respectivamente, en forma solapada. Para subregión VP2 ---VP4; el par de primers está indicado en negrita y subrayado. El tamaño esperado del mismo es de 975 pb. TTGCTATAGTTAAGGTTGCG 53.6 C y RC GACAGCATCTGCAACTCC 55.0 C GGAGTTGCAGATGCTGTC Para subregión VP4 ---VP3; el par de primers está indicado en itálica y subrayado. Siendo el tamaño esperado de 1031 pb. AAATTTACTCCTTGGGCTG 54.5 C y RC ACTACGGCAGAACTACTAACC 53.0 C GGTTAGTAGTTCTGCCGTAGT 69

87 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS En el caso de la subregión VP1; el par de primes está indicado en rojo y subrayado, siendo el tamaño esperado del amplicon de 864 pb. ATCCTGCCGCTATGTATACT 54.1 C y RC ACAAGTGTCAGCTATTGCC 53.7 C GGCAATAGCTGACACTTGT En la secuencia completa (ver genoma completo; arriba) en caja, se indican los primers TrV1a y TrV1b utilizados para la PCR diagnóstica, en la subregión ---VP3---VP1--. Para este par de primers el tamaño esperado es de 832 pb. Las secuencias obtenidas de ambas cadenas de cada producto de PCR por región amplificada se describen en el anexo secuencias, al final del capítulo. Se ha podido amplificar parte de la VP4 en la PCR con los primers VP4/VP3 y VP2/VP4. A la vez, la región TrV1a y TrV1b solapa con la región diseñada para amplificar VP3/VP1. En el apartado se detallan las secuencias obtenidas, por región. Primero nucleótidos, luego aminoácidos, con sus respectivos alineamientos e hipótesis filogenéticas propuestas en cada caso (Ver anexo Secuencias). En base a las secuencias obtenidas, estas se alinearon con el programa MEGA usando el algoritmo ClustalW (CLUSTAL 2.1). Se compararon con la cepa de referencia (AF178440) y con la cepa TIN1 (HM044313) de nuestro laboratorio. En el anexo se grafican todas las secuencias obtenidas para la región comprendida por los primers TrV1a y TrV1b de nucleótidos; alineamiento y árbol. Para la realización de la reconstrucción filogenética de nucleótidos, fueron utilizados 15 taxones. El método elegido fue el de Neighbor-Joining con un Bootstrap de 1000 replicas. El modelo utilizado fue el de Maximum Composite Likelihood. El porcentaje de identidad de secuencias varió entre 99,3 y 100% (10 cambios de nucleótidos). Se utilizo el mismo procedimiento para los aminoácidos. Para la realización de la reconstrucción filogenética de aminoácidos, fueron utilizados 15 taxones con el método de Neighbor-Joining y un Bootstrap de 1000 replicas. El modelo utilizado fue el de Poisson 70

88 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS correction. El porcentaje de identidad de secuencias de aminoácidos vario entre 98,9 y 100% (4 cambios aminoacídicos). Luego para la subregión VP2/VP4 (nucleotidos); y para la misma subregión en el caso de los aminoácidos. El diseño de estos primers permitió amplificar una zona intergénica previa al ORF2. Debido a la presencia de un codón de stop (TAG) la traducción comienza en el codón CTC. El porcentaje de identidad de secuencias nucleotídicas varió entre 99,5 y 100% (6 cambios de nucleótidos). El porcentaje de identidad de secuencias aminoacídicas varió entre 99,6 y 100% (un solo cambio aminoacídico). Para el caso de la región VP4/VP3; el porcentaje de identidad de secuencias nucleotídicas varió entre 99,3 y 100% (8 cambios nucleotidicos) y el porcentaje de identidad de secuencias aminoacídicas varió entre 99,1 y 100% (3 cambios de aminoácidos). En cuanto a la región VP1: el diseño de estos primers permitió amplificar la región VP1 y una zona no traducida cercana al 3 final del ORF2. Debido a la presencia de un codón de stop (TAG) la traducción finaliza. El porcentaje de identidad de secuencias nucleotídicas varió entre 99,8 y 100% (2 cambios de nucleotidos) que involucran la región no traducida 3. El porcentaje de identidad de secuencias aminoacídicas es del 100%. Para las ultimas tres regiones, nos pareció redundante la realización de árboles filogenéticos, es por ello que no vimos necesaria la inclusión de los mismos en este apartado MICROSCOPIA ELECTRONICA DE TRANSMISION (MET) Al microscopio electrónico se observaron numerosas partículas virales en todas las muestras positivas para PCR de la materia fecal de los triatominos analizados. Esto se realizó para la confirmación de los insectos positivos a TrV, como así también para muestras negativas (algunas); elegidas en forma azarosa y realizando pooles de las mismas (Fig. 2v). 71

89 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS A B C D Figura 2v: Técnica de tinción negativa. Observación de partículas virales de TrV a distintos aumentos. A: 80K. B, C y D: 250K DISCUSION Tal como se mencionó en el Capítulo I, TrV es el único virus identificado en triatominos hasta el momento. Resultados anteriores han mostrado la presencia de TrV en T. infestans sólo en domicilio y peridomicilio y T. sordida en un domicilio de la provincia de Chaco, especie que invade las viviendas pero que habita principalmente el ambiente silvestre y peridomiciliario (Muscio, 1988, Marti et al., 2009). En los domicilios no se han podido encontrar resultados positivos debido a que el número de muestras fueron escasas mientras que en 7 de las 10 provincias analizadas se encontró la presencia de TrV en el peridomicilio. Si 72

90 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS se incrementara el número de muestras en los domicilios seguramente se obtendrían resultados similares a los encontrados por Marti et al., Sin embargo, en este trabajo no solo se encontró a TrV asociado a los peridomicilios sino que se lo halló en el ambiente silvestre en diversas especies como T. breyeri, T. infestans, T. guasayana, T. delpontei, T. platensis y Ps. coreodes. A excepción de T. infestans, las especies anteriormente mencionadas son encontradas habitualmente en el ambiente silvestre, pero el hallazgo de T. infestans en nidos de aves es sumamente relevante. En Sudamérica son escasos los hallazgos de T. infestans en el ambiente silvestre, limitándose al Chaco Boliviano, en huecos de arboles y nidos de loros (Noireau et al., 1997; 1999; 2000 y Waleckx et al., 2012); en Chile, relacionados a pilas de rocas (Bacigalupo et al., 2006); en Paraguay, en ramas secas y huecos de árboles (Yeo et al., 2005 y Rolón et al., 2011) y en Argentina, asociados a Amazona aestiva (Psittaciidae) (Ceballos et al., 2009). En nuestro país, los primeros reportes de la presencia de T. infestans en nidos de aves fueron mencionados por Massa en la década del 30 y posteriormente, en 1980 Carpintero, encuentra a T. infestans en nidos de furnáridos y en otras especies de aves (Turienzo y Di Iorio, 2007). Aunque el objetivo de este trabajo no fue el estudio ecológico de los triatominos, consideramos relevante la importancia de este hallazgo, ya que ante la eliminación de T. infestans de domicilios y peridomicilios, los focos silvestres podrían ser los que colonicen nuevamente éstos hábitat. La presencia de TrV en 5 especies silvestres en Chaco (T. infestans, T. guasayana, T. delpontei, T. platensis y Ps. coreodes) y de 3 especies en La Rioja (T. breyeri, T. guasayana y T. delpontei) nos indican que seguramente realizando una búsqueda más metódica en otras provincias Argentinas podría aumentar aún más las evidencias que el virus está circulando en la naturaleza. La presencia de TrV en especies silvestres y de peridomicilios así como la presencia de T. infestans y T. delpontei co-habitando el mismo sitio en la zona de El Palmar en la provincia de Chaco, nos podría indicar que el virus se encuentra en todos los ambientes (domiclio, peridomicilio y silvestre). La naturaleza refractaria de las aves a T. cruzi es citada numerosas veces (Texeira 73

91 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS et al., 2006) y las aves también son consideradas refractarias a TrV como ocurre con el parásito, o pueden desarrollar anticuerpos como respuesta, si fueron infectados con TrV. Aunque esto no fue estudiado hasta ahora, las aves podrían ser consideradas como reservorios de TrV, asumiendo que los triatominos se alimentan de estos. Sin embargo la experiencia en el laboratorio muestra que al menos las gallinas no manifiestan signos clínicos; estas sirven de alimento al insectario y han desarrollado anticuerpos específicos a TrV (Marti, comunicación personal). Hasta el momento 9 especies de triatominos han sido reportadas como susceptibles a TrV tanto en laboratorio como en insectos de campo (Muscio 1988; Rozas Dennis et al., 2002; Marti et al., 2009). La presencia de TrV en materia fecal de T. breyeri y Ps. coreodes como nuevos hospedadores, incrementa a 11 el número de especies susceptibles al virus. Muscio y colaboradores reportan a TrV en T. infestans en peridomicilios del paraje Media Naranja de la Provincia de Córdoba (Muscio et al., 1988) y posteriormente, se lo encuentra en domicilios y peridomicilios de 8 provincias de Argentina (Marti et al., 2009). Los resultados obtenidos en la presente investigación contribuyeron a ampliar la distribución del virus en varias especies del ambiente silvestre, incrementándose de esta manera la posibilidad de un potencial uso como agente de control biológico contra los vectores de la enfermedad de Chagas. Hasta el presente los programas para el control de la Tripanosomiasis Americana se basan exclusivamente en el uso de químicos dentro de las viviendas y alrededor de ellas y no se ha llevado a cabo ninguna prueba con TrV en el ambiente silvestre con agentes biológicos conocidos. El esclarecimiento de la diversidad y el número, hospederos y efectos patogénicos quizás revelen los roles principales de Dicistrovirus en la biosfera (Bonning y Miller, 2010). La prevalencia de TrV en Argentina ya ha sido parcialmente estudiada, sin embargo en triatominos de otras áreas endémicas para la enfermedad en el resto de Latinoamérica, es aún desconocido. Las colonias de triatominos que viven en insectarios de países de América Latina reciben periódicamente nuevos insectos del campo, los cuales pueden estar infectados con TrV. Teniendo en cuenta esta posibilidad, los insectarios podrían ser fuente del virus. Esta es una de las razones por la cual la 74

92 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS presencia de TrV en los insectarios de América Latina deberían ser estudiados y evaluados, ya que colonias libres de TrV estarían bajo un alto riesgo de infección y de este modo podrían destruir insectarios. Las proteínas de la cápside viral han demostrado ser el objetivo para estudios filogenéticos en otros Dicistrovirus (Hunter at al., 2006; Tapaszti et al., 2009). De Miranda mostró que el aislamiento del Kashmir bee virus y el virus de la parálisis de la abeja, pueden ser en términos generales separados por su origen geográfico, pero es más difícil identificar tendencias regionales dentro de cada lugar geográfico (continente) (De Miranda et al., 2004). En el caso del Black Queen Cell Virus (BQCV), Tapaszti, describe que el ORF1, cerca de su extremo 5 a nivel de la helicasa (583 pares de bases), es mucho más variable que otras regiones incluso del mismo ORF1 y respecto al ORF2 y que en general, el agrupamiento filogenético logrado en su trabajo corresponde a un origen geográfico de los genotipos, como es el caso del Acute Bee Paralysis Virus (ABPV) (Tapaszti et al., 2009). En otros casos esto no ocurre. Sin embargo, estos autores, realizan una filogenia basada en las proteínas estructurales del ORF2 (514 pares de bases) que brindó mayor resolución que utilizando el ORF1, y permitió separar cepas de Polonia, Austria y Hungría. Esto no podemos analizarlo ya que aún no se ha descripto a TrV en otros países que no sea Argentina. Otros autores, sin embargo, obtuvieron dos linajes distintos analizando la región IG y parte del ORF2 en Israeli Acute Paralisis Virus IAPV- (Blanchard et al., 2008). Con respecto al análisis de las secuencias descriptas en nuestro caso, las mutaciones encontradas a nivel nucleotídico resultaron en cambios de aminoácidos en distintas posiciones: esto quedó evidenciado en todas las regiones analizadas. En la región comprendida por los primers TrV1a y TrV1b, los cambios fueron 10 nucleótidos correspondientes a 4 cambios aminoacídicos. En la subregión VP2/VP4 fueron 6 los cambios de nucleótidos dando lugar a un solo cambio aminoacídico. La región VP4/VP3 tuvo 8 cambios nucleotídicos correspondientes a 3 de aminoácidos. En cuanto a la región VP1 fueron 2 los cambios de nucleótidos que no involucraron cambios aminoacídico, (mutación silenciosa). Nos hemos encontrado con la dificultad en cuanto al bajo porcentaje de recuperación de ARN en las muestras de materia fecal de los triatominos 75

93 CAPÍTULO II: DIVERSIDAD DE TrV EN TRIATOMINOS analizados. Esto lo atribuimos principalmente al hecho de que, a pesar de cuidar al extremo los materiales para trabajar y disminuir al mínimo el riesgo de contaminación que hace que el ARN se inactive, las muestras conservadas en agua libre de nucleasas a -20 C no se podían recuperar en su totalidad. Eso llevó a que cada vez que debíamos probar un nuevo juego de primers para amplificar determinada secuencia, tuviéramos que partir de muestras de materia fecal y no de ARN ya extraído con anterioridad. Las muestras de materia fecal, si bien son sumamente provechosas, también son limitadas para los subsiguientes usos. Aunque el número de secuencias genómicas analizadas en Argentina es bajo y sólo se ha hallado hasta el momento la presencia de una muestra positiva a TrV de T. infestans, en Bolovia, nos permite abrir las puertas para futuras investigaciones. Una muestra diagnosticada por AC-ELISA durante el 2005 en la localidad de Tarija, Bolivia (Marti, comunicación personal) nos lleva a realizar futuras investigaciones en triatominos de Bolivia y Paraguay. Complementando a estos estudios en este momento también se están realizando estudios serológicos en sueros humanos obtenidos de localidades donde se ha encontrado la presencia de TrV en Argentina y en algunas localidades del sur de Bolivia. Paralelamente a estos estudios también se está realizando un relevamiento en insectarios de Latinoamérica para poder afirmar de esta manera en que especies de triatominos encontramos a TrV y si solo se encuentra en Argentina. 76

94 CAPÍTULO II: ANEXO TABLAS Tabla A: Muestras del ambiente silvestre (Provincia de Chaco) mostrando localidad y tipo de colecta; especie y número de insectos por muestra (N). MUESTRA LOCALIDAD COLECTA ESPECIE N El Palmar (1) Manual Cardón seco T. guasayana 24 4 El Palmar (1) Manual Palmera T. guasayana El Palmar (1) Manual nido-cotorra T. delpontei T. infestans El Palmar (1) Manual nido-furnarido T. infestans T. platensis T. guasayana Ps. coreodes P. guentheri El Palmar (1) Pasiva Trampa de luz T. infestans P. guentheri T. guasayana 2 1 El Palmar (2) Manual Palmera T. infestans El Palmar (2) Manual volando - al humano T. guasayana El Palmar (2) Pasiva Trampa de luz T. infestans T. guasayana P. guentheri 9 2 Tres Estacas Manual Corteza T. sordida Las Breñas Manual Nido-furnarido Ps. coreodes 18 T. platensis El Picazo Manual Nido-furnarido Ps. coreodes 4 75

95 CAPÍTULO II: ANEXO TABLAS Tabla B: Muestras del ambiente silvestre (Provincia de La Rioja) mostrando localidad y tipo de colecta; especie y número de insectos por muestra (N). MUESTRA LOCALIDAD COLECTA ESPECIE N 61 Patquia Viejo Manual Nido-furnarido T. garciabesi Patquia Viejo Manual Nido -cotorra T. delpontei Patquia Viejo Pasiva Trampa de luz T. breyeri T. garciabesi T. guasayana 6 T. platensis 2 T. infestans Patquia Viejo Pasiva Trampa Noireau T. breyeri T. infestans Salinas de Bustos Manual nido-furnarido T. platensis 2 Ps. coreodes 1 97 Salinas de Bustos Manual volando al humano T. guasayana 19 T. eraturysiforme Salinas de Bustos Pasiva Trampa de luz T. eraturysiforme T. garciabesi 1 T. guasayana 7 T. platensis 1 69 Salinas de Bustos Pasiva Trampa Noireau T. breyeri 1 76

96 CAPÍTULO II: ANEXO TABLAS Tabla C: Tabla coordenadas de las áreas silvestres (Provincias de Chaco y La Rioja) donde se realizaron las colectas y total de especies silvestres. En el mapa se detallan los lugares de muestreo en Chaco y La Rioja. LOCALIDADES COORDENADAS El Plamar 1 S 27º ' O 61º ' El Palmar 2 S 27 08' 14" O 61 34' 26,1" Las Breñas S 26 48' 58,4" O 61 34' 14,7" Tres Estacas S 26 55' 36,5" O 61 38' 10,7" Salinas de Bustos S 30 12' 522" O 67 35' 367" Patquia Viejo S 30 10' 243" O 66 57' 251" 77

97 CAPÍTULO II: ANEXO TABLAS Total de especies silvestres. ESPECIES TOTALES Panstrongilus guentheri 14 Psammolestes coreodes 125 Triatoma breyeri 90 Triatoma delpontei 175 Triatoma eratyrusiforme 8 Triatoma garciabesi 26 Triatoma guasayana 68 Triatoma infestans 70 Triatoma platensis 29 Triatoma sordida 1 78

98 CAPÍTULO II: ANEXO TABLAS Tabla D: Muestras de triatominos en domicilio y peridomicilio mostrando provincia y localidad; tipo de colecta, especie y número de insectos por muestra (N). Además se detalla el total de especies. MUESTRA PROVINCIA LOCALIDAD COLECTA ESPECIE N Chaco Pinedo Peridomicilio P. guentheri T. infestans T. guasayanas Chaco Pinedo Domicilio P. guentheri 2 T. infestans La Rioja Salinas de Bustos Domicilio T. infestans La Rioja Salinas de Bustos Peridomicilio T. infestans 61 T. guasayana 1 26 Chaco Patquia Viejo Peridomicilio T. infestans Santa Fe Los Nocheros Peridomicilio T. infestans 35 2 Santiago del Estero Sachayoj Peridomicilio T. infestans 4 31,32 Chaco Tres Estacas Peridomicilio T. infestans Santiago del Estero Corral Quemado Peridomicilio T. infestans 20 Total de especies de domicilio y peridomicilio. ESPECIES Nº Triatoma infestans 578 Triatoma guasayana 9 Panstrongilus guentheri 3 Total

99 CAPÍTULO II: ANEXO TABLAS Tabla E: Muestras del Material conservado en la colección del Centro de Estudios Parasitológicos y de Vectores (CEPAVE) mostrando provincia y localidad; tipo de colecta, especie y número de insectos por muestra (N). MUESTRA PROVINCIA LOCALIDAD COLECTA ESPECIE N 1 Buenos Aires Carhué Peridomicilio T. infestans 4 2 Chaco Pampa del zorro Peridomicilio T. infestans 25 3 La Rioja Anillaco Domicilio T. guasayana 1 4 La Rioja Anillaco Domicilio T. guasayana 1 5 Chaco Pampa Avila Peridomicilio T. infestans 15 6 Formosa Pozo del Tigre Domicilio T. infestans 40 7 Tucumán Leales Domicilio T. infestans 20 8 Santa Fe Los Nocheros Peridomicilio T. infestans 20 9 La Rioja San Blas Peridomicilio T. infestans Chaco El Palmar Peridomicilio T. infestans Chaco El Palmar Peridomicilio T. infestans San Luis Lomas Blancas Domicilio T. infestans San Luis El Zampal Peridomicilio T. infestans Mendoza San Gabriel Peridomicilio T. infestans Tucumán Simoca Peridomicilio T. infestans Tucumán Leales Domicilio T. infestans Tucumán Simoca Peridomicilio T. infestans Tucumán Leales Peridomicilio T. infestans Tucumán Leales Peridomicilio T. infestans Tucumán Leales Peridomicilio T. infestans Santiago del Estero Río Hondo Peridomicilio T. infestans La Rioja Cuatro Esquinas Peridomicilio T. infestans La Rioja La Lomita Peridomicilio T. infestans La Rioja Anillaco Peridomicilio T. infestans La Rioja Anillaco Peridomicilio T. infestans 5 26 Santiago del Estero Jimenez Peridomicilio T. infestans Santiago del Estero La Lomita Domicilio T. infestans 10 80

100 CAPÍTULO II: ANEXO TABLAS Tabla F: Muestras del Material conservado en la colección de otros centros de investigación mostrando provincia y localidad; tipo de colecta, especie y número de insectos por muestra (N). MUESTRA PROVINCIA LOCALIDAD COLECTA ESPECIE N 1 Córdoba Dpto. Ischilin Loe Chuña Peridomicilio T. infestans 20 2 Córdoba Dpto. Ischilin Loe Chuña Peridomicilio T. infestans 20 3 Chaco Dpto. Guemes, Loc. Castelli Peridomicilio T. infestans 20 4 Chaco Dpto. Guemes, Loc. Castelli Peridomicilio T. infestans 20 5 Chaco Dpto. Guemes, Loc. Castelli Peridomicilio T. infestans 20 6 Chaco Dpto. Guemes, Loc. Castelli Peridomicilio T. infestans 20 81

101 CAPÍTULO II: ANEXO SECUENCIAS Región TrV1a y TrV1b Nucleótidos: >AF TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAG GTTAAAGCCTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >PCO1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TDE1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TDE2 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGCACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA 82

102 CAPÍTULO II: ANEXO SECUENCIAS 83 >TIN1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACAGTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN2 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN3 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGCACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN4 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAATTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN5

103 CAPÍTULO II: ANEXO SECUENCIAS 84 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN6 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN7 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN8 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN9 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT

104 CAPÍTULO II: ANEXO SECUENCIAS 85 ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAGATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN10 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN11 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN12 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGTTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA >TIN13 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGATGATGTTATGGA TTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCT ACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTC CTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACT

105 CAPÍTULO II: ANEXO SECUENCIAS TTGTGTTTCTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAGTTGAG GTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTACCCGTAGATTCTTTGACAG AGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTTTTGCTTCAGCAGGTACTCGTGATATCCGTTC TTCTTATGTTGAGGGGAAATTTATTCCTCAGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAG CCTTCTCAAGAATGTATTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACG TTTCTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATACTGCTGCTGA CAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTGCTATGTAC GCATTTTATAGGGGGGGAATAAGGCTGAA Alineamiento de nucleótidos (CLUSTAL 2.1) TIN11 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN13 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN8 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN6 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN5 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TDE1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN7 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN3 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TDE2 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN12 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 PCO1 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN2 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 AF TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN4 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN9 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 TIN10 TCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATG 60 ************************************************************ TIN11 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN13 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN8 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN6 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN5 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TDE1 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN1 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN7 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN3 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TDE2 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN12 ATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 PCO1 ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN2 ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 AF ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN4 ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN9 ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 TIN10 ATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCG 120 *************************.********************************** TIN11 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN13 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN8 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN6 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN5 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TDE1 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN1 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN7 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN3 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TDE2 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN12 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 PCO1 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN2 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT

106 CAPÍTULO II: ANEXO SECUENCIAS AF TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN4 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN9 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 TIN10 TAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTT 180 ************************************************************ TIN11 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN13 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN8 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN6 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN5 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TDE1 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN1 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN7 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN3 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TDE2 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 TIN12 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACTATGAACCTA 240 PCO1 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTA 240 TIN2 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTA 240 AF ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTA 240 TIN4 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTA 240 TIN9 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAGATACAACTATGAACCTA 240 TIN10 ATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACTATGAACCTA 240 *****************************************..***************** TIN11 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN13 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN8 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN6 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN5 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TDE1 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN1 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN7 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN3 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TDE2 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN12 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 PCO1 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN2 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 AF GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN4 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN9 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 TIN10 GAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACACTTTGTGTTT 300 ************************************************************ TIN11 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN13 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN8 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN6 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN5 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TDE1 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN1 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN7 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN3 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TDE2 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 TIN12 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 PCO1 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAG 360 TIN2 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAG 360 AF CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAG 360 TIN4 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAG 360 TIN9 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCGACTATAGATGTTTTAG 360 TIN10 CTGCTTTAACTCCTCTGGTTAGTAGTTCTGCCGTAGTCTCTTCAACTATAGATGTTTTAG 360 *******************************************.**************** TIN11 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN13 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC

107 CAPÍTULO II: ANEXO SECUENCIAS TIN8 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN6 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN5 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TDE1 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN1 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN7 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN3 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TDE2 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN12 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 PCO1 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN2 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 AF TTGAGGTTAAAGCCTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN4 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN9 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 TIN10 TTGAGGTTAAAGCTTCAGATGATTTTGAAGTTGCTGTCCCAAACACGCCTTTATGGTTAC 420 ************* ********************************************** TIN11 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN13 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN8 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN6 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN5 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TDE1 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN1 CCGTAGATTCTTTGACAGAGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN7 CCGTAGATTCTTTGACAGAGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN3 CCGTAGATTCTTTGACAGAGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TDE2 CCGTAGATTCTTTGACAGAGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN12 CCGTAGATTCTTTGACAGAGAGGCCTTCGTTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 PCO1 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN2 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 AF CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN4 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN9 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 TIN10 CCGTAGATTCTTTGACAGAGAGGCCTTCATTAGATGGTGTTCCTATTGCACAAGTAGGTT 480 ****************************.******************************* TIN11 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN13 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN8 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN6 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN5 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TDE1 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN1 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN7 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN3 TTGCTTCAGCAGGCACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TDE2 TTGCTTCAGCAGGCACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN12 TTGTTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 PCO1 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN2 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 AF TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN4 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN9 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 TIN10 TTGCTTCAGCAGGTACTCGTGATATCCGTTCTTCTTATGTTGAGGGGAAATTTATTCCTC 540 *** ********* ********************************************** TIN11 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN13 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN8 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN6 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN5 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TDE1 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN1 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN7 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN3 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TDE2 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA

108 CAPÍTULO II: ANEXO SECUENCIAS TIN12 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 PCO1 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN2 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 AF AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN4 AGGATATAACTGGAATGTCTAGAAATCATGAATTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN9 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 TIN10 AGGATATAACTGGAATGTCTAGAAATCATGAACTTGATGAACAGCCTTCTCAAGAATGTA 600 ******************************** *************************** TIN11 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN13 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN8 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN6 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN5 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TDE1 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN1 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN7 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN3 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TDE2 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN12 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 PCO1 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN2 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 AF TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN4 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN9 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 TIN10 TTGGTGAAAGAATCTTATCTTTTTCTGAATTGATTAAGAGAAATTCTTGGCGATACGTTT 660 ************************************************************ TIN11 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN13 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN8 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN6 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN5 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TDE1 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN1 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN7 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN3 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TDE2 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN12 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 PCO1 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN2 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 AF CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN4 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN9 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 TIN10 CTGACGAGAAGAGTTTGATTTATCCAGCTTATGCCTTTGACAATCCTGCCGCTATGTATA 720 ************************************************************ TIN11 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN13 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN8 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN6 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN5 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TDE1 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN1 CTGCTGCTGACAAACTACCTGTTTGGACAGTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN7 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN3 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TDE2 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN12 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 PCO1 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN2 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 AF CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN4 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN9 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 TIN10 CTGCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGT 780 ***************************** ****************************** 89

109 CAPÍTULO II: ANEXO SECUENCIAS TIN11 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN13 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN8 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN6 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN5 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TDE1 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN1 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN7 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN3 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TDE2 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN12 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 PCO1 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN2 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 AF TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN4 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN9 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 TIN10 TGACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAA 832 **************************************************** Árbol filogenético de nucleótidos TIN1 88 TIN5 TIN13 TIN11 TIN8 TDE1 TIN6 TIN TIN7 PCO1 TIN2 64 TIN12 TDE2 TIN3 TIN9 AF TIN

110 CAPÍTULO II: ANEXO SECUENCIAS 91 Aminoácidos: >AF KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP KYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >PCO1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP KYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TDE1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TDE2 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTVTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN2 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP KYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN3 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN4 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP KYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHEFDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN5 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN6

111 CAPÍTULO II: ANEXO SECUENCIAS KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN7 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN8 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN9 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP RYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN10 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP KYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN11 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN12 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFVSAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL >TIN13 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRP EYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTE RPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYV SDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL Alineamiento de aminoácidos (CLUSTAL 2.1) TIN11 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN13 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN8 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN7 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN6 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN5 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TDE2 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 92

112 CAPÍTULO II: ANEXO SECUENCIAS TIN3 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TDE1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN12 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN9 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 PCO1 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN2 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 AF178440KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN10 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 TIN4 KTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPY 60 ************************************************************ TIN11 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN13 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN8 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN7 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN6 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN5 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TDE2 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN3 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TDE1 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN12 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN1 KVCADVFNSANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN9 KVCADVFNSANRPRYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 PCO1 KVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN2 KVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 AF KVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN10 KVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 TIN4 KVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLV 120 *************.********************************************** TIN11 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN13 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN8 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN7 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN6 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN5 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TDE2 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN3 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TDE1 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN12 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFVSAGTRDIRSSYVEGKFIPQ 180 TIN1 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN9 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 PCO1 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN2 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 AF EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN10 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 TIN4 EVKASDDFEVAVPNTPLWLPVDSLTERPSLDGVPIAQVGFASAGTRDIRSSYVEGKFIPQ 180 ****************************************.******************* TIN11 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN13 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN8 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN7 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN6 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN5 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TDE2 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN3 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT

113 CAPÍTULO II: ANEXO SECUENCIAS TDE1 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN12 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN1 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN9 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 PCO1 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN2 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 AF DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN10 DITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 TIN4 DITGMSRNHEFDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYT 240 **********:************************************************* TIN11 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN13 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN8 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN7 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN6 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN5 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TDE2 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN3 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TDE1 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN12 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN1 AADKLPVWTVTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN9 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 PCO1 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN2 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 AF AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN10 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 TIN4 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRL 276 *********:************************** Árbol filogenético de aminoácidos 94

114 CAPÍTULO II: ANEXO SECUENCIAS TDE1 TIN1 TIN11 TIN TIN8 TIN5 TIN12 TIN13 TDE2 TIN6 TIN7 TIN9 AF TIN10 PCO1 TIN2 TIN4 95

115 CAPÍTULO II: ANEXO SECUENCIAS Región VP2-VP4 Nucleótidos y aminoácidos: >AF ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTCGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTCGAAATCAGATTACTACTTTTGTACATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >AF LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVHDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV >TIN1 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTCGAAATCAGATTACTACTTTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >TIN1 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV >TIN4 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTTGAGTCGGGTTTGGAATCTAAAGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTAGAAATCAGATTACTACTTTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAACTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT 96

116 CAPÍTULO II: ANEXO SECUENCIAS 97 TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >TIN4 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV >TIN6 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTCGAAATCAGATTACTACTTTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >TIN6 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV >TIN8 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTCGAAATCAGATTACTACTTTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAAGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >TIN8 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV >TIN13 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAGAATTTTCCTATAC CTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTAAATATGAAACAAATGAATGTAAATTC TTCTCAGGATACTACATTTGAACAAAGATCTCAAGAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAG TTTCGAAATCAGATTACTACTTTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCAC AGCCTTCGGGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGACCCCA

117 CAPÍTULO II: ANEXO SECUENCIAS GTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTTTCCTTGAAATTACCTGAT GCACTTATGTCACCTATGATTAGAGAAAAACTATCTGGTTTTACATCTTTTAGTGCTAGTACCGTCTTTCATA TACAAGTAAATGCTCATCCATTTCAATGTGGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACC TCTACATAGGTTGAACATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATT AGCAAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTTGTTACAAAAT TTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGT TAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAA GAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTG >TIN13 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIGDSPQPSGDVRSVS DARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQC GRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAH VYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV Alineamiento de nucleótidos(clustal 2.1) TIN1 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 AF ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 TIN6 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 TIN8 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 TIN13 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 TIN4 ATTTAGGCATACTTCTCAGGATGGCGCGTTGCAGTCCAACAAGATCCAGGGACTGTACAG 60 ************************************************************ TIN1 AATTTTCCTATACCTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTA 120 AF AATTTTCCTATACCTCGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTA 120 TIN6 AATTTTCCTATACCTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTA 120 TIN8 AATTTTCCTATACCTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTA 120 TIN13 AATTTTCCTATACCTTGAGTCGGGTTTGGAATCTAAGGTTGACTCGCTGTAAATAATGTA 120 TIN4 AATTTTCCTATACCTTGAGTCGGGTTTGGAATCTAAAGTTGACTCGCTGTAAATAATGTA 120 *************** ********************.*********************** TIN1 AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 AF AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 TIN6 AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 TIN8 AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 TIN13 AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 TIN4 AATATGAAACAAATGAATGTAAATTCTTCTCAGGATACTACATTTGAACAAAGATCTCAA 180 ************************************************************ TIN1 GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACT 240 AF GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACT 240 TIN6 GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACT 240 TIN8 GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACT 240 TIN13 GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTCGAAATCAGATTACTACT 240 TIN4 GAGAAGGTGCAAGCTGGAGAAATTAATGAGAGTATTGAGTTTAGAAATCAGATTACTACT 240 ******************************************.***************** TIN1 TTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 AF TTTGTACATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 TIN6 TTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 TIN8 TTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 TIN13 TTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 TIN4 TTTGTAGATGATAATCCGATAATCACTGAGCAACTAATTGGAGATAGTCCACAGCCTTCG 300 ****** ***************************************************** TIN1 GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA 360 AF GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA 360 TIN6 GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA 360 TIN8 GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA

118 CAPÍTULO II: ANEXO SECUENCIAS TIN13 GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA 360 TIN4 GGTGACGTTAGATCGGTTAGTGATGCTCGAACTCATTCTATTATTGATTTCTTAGAAAGA 360 ************************************************************ TIN1 CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 AF CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 TIN6 CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 TIN8 CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 TIN13 CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 TIN4 CCCCAGTTTATTGGATCTTTTCTTTGGAACACAAGTGATATTGAAAATAAAGAAATCTTT 420 ************************************************************ TIN1 TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTT 480 AF TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTT 480 TIN6 TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTT 480 TIN8 TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAATTATCTGGTTTT 480 TIN13 TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAACTATCTGGTTTT 480 TIN4 TCCTTGAAATTACCTGATGCACTTATGTCACCTATGATTAGAGAAAAACTATCTGGTTTT 480 ************************************************ *********** TIN1 ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 AF ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 TIN6 ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 TIN8 ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 TIN13 ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 TIN4 ACATCTTTTAGTGCTAGTACCGTCTTTCATATACAAGTAAATGCTCATCCATTTCAATGT 540 ************************************************************ TIN1 GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 AF GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 TIN6 GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 TIN8 GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 TIN13 GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 TIN4 GGAAGATTGGTTTTAGCTGCTGTACCTGTTCCAGATATTTTACCTCTACATAGGTTGAAC 600 ************************************************************ TIN1 ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 AF ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 TIN6 ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 TIN8 ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 TIN13 ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 TIN4 ATGTTAAGTTTTGATGTTTCTAATGTCATAACTTTACCTCATGTGCAATTGGATATTAGC 660 ************************************************************ TIN1 AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 AF AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 TIN6 AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 TIN8 AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 TIN13 AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 TIN4 AAGGAAACAGAAGTCTTATTGAAGATTCCTTATGTTTCACCCTTTGTTCAGTATGATCTT 720 ************************************************************ TIN1 GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 AF GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 TIN6 GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 TIN8 GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 TIN13 GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 TIN4 GTTACAAAATTTACTCCTTGGGCTGCCTTTTTGGCACATGTGTATGCTCCTCTTAATACT 780 ************************************************************ TIN1 CCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC 840 AF CCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC 840 TIN6 CCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC 840 TIN8 CCATCTGCTGCTTCATTGCAAGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC 840 TIN13 CCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC

119 CAPÍTULO II: ANEXO SECUENCIAS TIN4 CCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGAAGACATCAAACTAGGC 840 ********************.*************************************** TIN1 TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 AF TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 TIN6 TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 TIN8 TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 TIN13 TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 TIN4 TTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGTGGT 900 ************************************************************ TIN1 TTAACAAACACTGTTACGGGTGTTG 925 AF TTAACAAACACTGTTACGGGTGTTG 925 TIN6 TTAACAAACACTGTTACGGGTGTTG 925 TIN8 TTAACAAACACTGTTACGGGTGTTG 925 TIN13 TTAACAAACACTGTTACGGGTGTTG 925 TIN4 TTAACAAACACTGTTACGGGTGTTG 925 ************************* Alineamiento de aminoácidos: TIN8 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIG 60 TIN13 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIG 60 TIN6 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIG 60 TIN4 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIG 60 TIN1 LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVDDNPIITEQLIG 60 AF LAVNNVNMKQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVHDNPIITEQLIG 60 ************************************************.*********** TIN8 DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 TIN13 DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 TIN6 DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 TIN4 DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 TIN1 DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 AF DSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIR 120 ************************************************************ TIN8 EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 TIN13 EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 TIN6 EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 TIN4 EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 TIN1 EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 AF EKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPH 180 ************************************************************ TIN8 VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 TIN13 VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 TIN6 VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 TIN4 VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 TIN1 VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 AF VQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHF 240 ************************************************************ TIN8 EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 TIN13 EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 TIN6 EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 TIN4 EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 TIN1 EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 AF EDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGV 274 ********************************** 100

120 CAPÍTULO II: ANEXO SECUENCIAS Región VP4-VP3 Nucleótidos y aminoácidos: >AF TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT CTGATGAGGTGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >AF AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEVALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT FRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSAL >TIN1 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGACCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAGGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT CTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTGGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTATCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >TIN1 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT FRFIKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSAL >TIN4 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT 101

121 CAPÍTULO II: ANEXO SECUENCIAS 102 CTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACGGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTAAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >TIN4 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT FRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSAL >TIN6 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT CTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >TIN6 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT FRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSAL >TIN12 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT CTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTGGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTATCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >TIN12 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT

122 CAPÍTULO II: ANEXO SECUENCIAS FRFIKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSAL >TIN13 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGTTTGCTCATTTTGA AGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAGGTAAAGAACAGTTAGGTCCTATAAGT GGTTTAACAAACACTGTTACGGGTGTTGTTGGAGGAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTG GAAAGTATGCCGATCCTCTGGTTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAA ACCTTTAACTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATGGTGTA GATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACACCTTTTGCCGGAACATCTT CTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATTACTTTTCTAGATTTAAATACTCGAGTACGTC CTTACCTAAGCAAGTATTGTGGACTTCTCCTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGAT GCTCCAGGGCAGCCTACTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATA CGTTTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTGTTGGGTATGA TGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATCGTGTAGTCGTAGACCTTCGTGAC CAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCCTTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATT CAGCAAATCGTCCTGAATACAACTATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTT TACAGGAACACTTTGTGTTTCTGCTTTA >TIN13 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGGVADAVKGFFPSIG KYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSS DEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYT FRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNS ANRPEYNYEPRDFKVYDNTTDQFFTGTLCVSAL Alineamiento de nucleótidos(clustal 2.1) TIN6 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 TIN13 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 AF TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 TIN4 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 TIN1 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 TIN12 TGGCACATGTGTATGCTCCTCTTAATACTCCATCTGCTGCTTCATTGCAGGTTAACGTGT 60 ************************************************************ TIN6 TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 TIN13 TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 AF TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 TIN4 TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 TIN1 TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 TIN12 TTGCTCATTTTGAAGACATCAAACTAGGCTTTCCTACTTCTGCTATTGTAGCTCAAGCAG 120 ************************************************************ TIN6 GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 TIN13 GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 AF GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 TIN4 GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 TIN1 GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 TIN12 GTAAAGAACAGTTAGGTCCTATAAGTGGTTTAACAAACACTGTTACGGGTGTTGTTGGAG 180 ************************************************************ TIN6 GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGATCCTCTGG 240 TIN13 GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGATCCTCTGG 240 AF GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGATCCTCTGG 240 TIN4 GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGATCCTCTGG 240 TIN1 GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGACCCTCTGG 240 TIN12 GAGTTGCAGATGCTGTCAAGGGGTTTTTCCCTTCTATTGGAAAGTATGCCGATCCTCTGG 240 **************************************************** ******* 103

123 CAPÍTULO II: ANEXO SECUENCIAS TIN6 TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 TIN13 TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 AF TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 TIN4 TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 TIN1 TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 TIN12 TTGGAATTGGCAATGGTTTGACTGGGTTATTGTCAGCTTTAGGTTTTTCCAAACCTTTAA 300 ************************************************************ TIN6 CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 TIN13 CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 AF CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 TIN4 CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 TIN1 CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 TIN12 CTACAATCCCGCCAACTATTGTTGTTCAACGACCCTCTCAATATTTTAATAATGCTGATG 360 ************************************************************ TIN6 GTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 TIN13 GTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 AF GTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 TIN4 GTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 TIN1 GTGTAGATCAGGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 TIN12 GTGTAGATCAAGGACTTCCTTTGAGTCTTAAATATGGAAATGAGGTTATTTTGAAAACAC 420 **********.************************************************* TIN6 CTTTTGCCGGAACATCTTCTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 TIN13 CTTTTGCCGGAACATCTTCTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 AF CTTTTGCCGGAACATCTTCTGATGAGGTGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 TIN4 CTTTTGCCGGAACATCTTCTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 TIN1 CTTTTGCCGGAACATCTTCTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 TIN12 CTTTTGCCGGAACATCTTCTGATGAGATGGCGCTGGAGTATGTTTTAAAAATACCTAATT 480 **************************.********************************* TIN6 ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 TIN13 ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 AF ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 TIN4 ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 TIN1 ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 TIN12 ACTTTTCTAGATTTAAATACTCGAGTACGTCCTTACCTAAGCAAGTATTGTGGACTTCTC 540 ************************************************************ TIN6 CTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGATGCTCCAGGGCAGCCTA 600 TIN13 CTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGATGCTCCAGGGCAGCCTA 600 AF CTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGATGCTCCAGGGCAGCCTA 600 TIN4 CTGTTCATCCTCAAATAATACGTAATCACGTTACGGTTGTTGATGCTCCAGGGCAGCCTA 600 TIN1 CTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGATGCTCCAGGGCAGCCTA 600 TIN12 CTGTTCATCCTCAAATAATACGTAATCACGTTACAGTTGTTGATGCTCCAGGGCAGCCTA 600 **********************************.************************* TIN6 CTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 TIN13 CTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 AF CTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 TIN4 CTTTGCTAGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 TIN1 CTTTGCTGGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 TIN12 CTTTGCTGGCTTATGCCACAGGATTTTTCAAATATTGGAGAGGTGGTCTCGTTTATACGT 660 *******.**************************************************** TIN6 TTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 TIN13 TTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 AF TTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 TIN4 TTAGATTTGTCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 TIN1 TTAGATTTATCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 TIN12 TTAGATTTATCAAAACTAACTATCATTCTGGAAGAGTCCAAATTACATTTCATCCCTTTG 720 ********.*************************************************** TIN6 TTGGGTATGATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATC

124 CAPÍTULO II: ANEXO SECUENCIAS TIN13 TTGGGTATGATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATC 780 AF TTGGGTATGATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATC 780 TIN4 TTGGGTATGATGATGTTATGGATTCGGATGGTAAGATAGTTAGAGATGAATACGTCTATC 780 TIN1 TTGGGTATGATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATC 780 TIN12 TTGGGTATGATGATGTTATGGATTCGGATGGTAAAATAGTTAGAGATGAATACGTCTATC 780 **********************************.************************* TIN6 GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 TIN13 GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 AF GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 TIN4 GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 TIN1 GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 TIN12 GTGTAGTCGTAGACCTTCGTGACCAGACTGAGGCTACTTTAGTAGTCCCTTTTACCTCCC 840 ************************************************************ TIN6 TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACT 900 TIN13 TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACT 900 AF TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACT 900 TIN4 TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTAAATACAACT 900 TIN1 TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACT 900 TIN12 TTACTCCTTATAAAGTGTGTGCGGATGTGTTTAATTCAGCAAATCGTCCTGAATACAACT 900 **************************************************.********* TIN6 ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 TIN13 ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 AF ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 TIN4 ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 TIN1 ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 TIN12 ATGAACCTAGAGACTTTAAGGTTTATGATAATACTACAGATCAGTTCTTTACAGGAACAC 960 ************************************************************ TIN6 TTTGTGTTTCTGCTTTA 977 TIN13 TTTGTGTTTCTGCTTTA 977 AF TTTGTGTTTCTGCTTTA 977 TIN4 TTTGTGTTTCTGCTTTA 977 TIN1 TTTGTGTTTCTGCTTTA 977 TIN12 TTTGTGTTTCTGCTTTA 977 ***************** Alineamiento de aminoácidos (CLUSTAL 2.1) TIN1 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 TIN12 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 TIN6 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 TIN13 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 AF AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 TIN4 AHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQAGKEQLGPISGLTNTVTGVVGG 60 ************************************************************ TIN1 VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 TIN12 VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 TIN6 VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 TIN13 VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 AF VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 TIN4 VADAVKGFFPSIGKYADPLVGIGNGLTGLLSALGFSKPLTTIPPTIVVQRPSQYFNNADG 120 ************************************************************ TIN1 VDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP 180 TIN12 VDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP 180 TIN6 VDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP 180 TIN13 VDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP 180 AF VDQGLPLSLKYGNEVILKTPFAGTSSDEVALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP 180 TIN4 VDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSP

125 CAPÍTULO II: ANEXO SECUENCIAS ****************************:******************************* TIN1 VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFIKTNYHSGRVQITFHPFV 240 TIN12 VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFIKTNYHSGRVQITFHPFV 240 TIN6 VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFV 240 TIN13 VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFV 240 AF VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFV 240 TIN4 VHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFV 240 ******************************************:***************** TIN1 GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPEYNY 300 TIN12 GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPEYNY 300 TIN6 GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPEYNY 300 TIN13 GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPEYNY 300 AF GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNY 300 TIN4 GYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNY 300 ********************************************************:*** TIN1 EPRDFKVYDNTTDQFFTGTLCVSAL 325 TIN12 EPRDFKVYDNTTDQFFTGTLCVSAL 325 TIN6 EPRDFKVYDNTTDQFFTGTLCVSAL 325 TIN13 EPRDFKVYDNTTDQFFTGTLCVSAL 325 AF EPRDFKVYDNTTDQFFTGTLCVSAL 325 TIN4 EPRDFKVYDNTTDQFFTGTLCVSAL 325 ************************* 106

126 CAPÍTULO II: ANEXO SECUENCIAS Region VP1 Nucleótidos y aminoácidos: >AF GCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTG CTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAAGATTGTTCCCGGTGTTGCCGATCAACCTAAACCTCT GGTAGAAGTGGCTTTGTTTACTATGCAGGATCAAGGCTATATCATTAAAGCTAATGATTATAGCACTGATTTC TGCTCGTCGAATATATATGAAAATTTTGTTACTAAAGGAATAGCAGAGGTACAAACTCCTTATTATTCAAGGG TTAATACCTCTGTTGTTTCTGCTCCTGTTCTTTATAACGCAGGTAATATTTCTCCACTAATGCCGAATGTTAT GTATAAGATAACATCAAATTCATCAAACATTCTGCTTGGTCATTCTGCTGCTGATGATTTCCGTTTTGGATTT CTCTTGGGAGCTCCATTAGCTATTTCAGCTACGGCTCTTAGAGATAACTTTACGGGATCCTCTGCTACAGTTT CTCTTCCTACCTTCTCAAATTTTTATCTATCTTCGACTTCAGAGTCCACTACTTAGAGGCTAGTGGTTGTTCG TACATTGGGTCAAGACTCAGTCTTGTTTTTCCGTATGTAAATATAAATATACATTCATTTATTGTAAATAATT ATATATATATAATTTTGTTTGTTTGTAAATAATGTGCTTTTATATGTTTGTGTCTGTGTCTTTCAGGTTTCTT CTTGATTCTTCCTGAGGGTACTAATCGAATCATGTATTTTGTTTTATTATTATATACGTTTTTGTTCGCTTTG TCCGTTCAGTGGACCAAGTTTT >AF VGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAY AFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYI IKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGH SAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLSSTSESTT* >TIN12 GCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTGACATCTATTGGTG CTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAAGATTGTTCCCGGTGTTGCCGATCAACCTAAACCTCT GGTAGAAGTGGCTTTGTTTACTATGCAGGATCAAGGCTATATCATTAAAGCTAATGATTATAGCACTGATTTC TGCTCGTCGAATATATATGAAAATTTTGTTACTAAAGGAATAGCAGAGGTACAAACTCCTTATTATTCAAGGG TTAATACCTCTGTTGTTTCTGCTCCTGTTCTTTATAACGCAGGTAATATTTCTCCACTAATGCCGAATGTTAT GTATAAGATAACATCAAATTCATCAAACATTCTGCTTGGTCATTCTGCTGCTGATGATTTCCGTTTTGGATTT CTCTTGGGAGCTCCATTAGCTATTTCAGCTACGGCTCTTAGAGATAACTTTACGGGATCCTCTGCTACAGTTT CTCTTCCTACCTTCTCAAATTTTTATCTATCTTCGACTTCAGAGTCCACTACTTAGAGGCTAGTGGTTGTTCG TACATTGGGTCAAGACTCAGTCTTGTTTTTCCGTATGTAAATATAAATATACATTCATTTATTGTAAATAATT ATATATATATGGTTTTGTTTGTTTGTAAATAATGTGCTTTTATATGTTTGTGTCTGTGTCTTTCAGGTTTCTT CTTGATTCTTCCTGAGGGTACTAATCGAATCATGTATTTTGTTTTATTATTATATACGTTTTTGTTCGCTTTG TCCGTTCAGTGGACCAAGTTTT >TIN12 VGFVSAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAY AFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYI IKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGH SAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLSSTSESTT Alineamiento de nucleótidos (CLUSTAL 2.1) TIN12 GCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTG 60 AF GCTGCTGACAAACTACCTGTTTGGACACTAACTCCTAGATCGGGTTTTCCCACTCTGTTG 60 ************************************************************ TIN12 ACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAAGATTGTTCCC 120 AF ACATCTATTGGTGCTATGTACGCATTTTATAGGGGGGGAATAAGGCTGAAGATTGTTCCC 120 ************************************************************ TIN12 GGTGTTGCCGATCAACCTAAACCTCTGGTAGAAGTGGCTTTGTTTACTATGCAGGATCAA 180 AF GGTGTTGCCGATCAACCTAAACCTCTGGTAGAAGTGGCTTTGTTTACTATGCAGGATCAA 180 ************************************************************ 107

127 CAPÍTULO II: ANEXO SECUENCIAS TIN12 GGCTATATCATTAAAGCTAATGATTATAGCACTGATTTCTGCTCGTCGAATATATATGAA 240 AF GGCTATATCATTAAAGCTAATGATTATAGCACTGATTTCTGCTCGTCGAATATATATGAA 240 ************************************************************ TIN12 AATTTTGTTACTAAAGGAATAGCAGAGGTACAAACTCCTTATTATTCAAGGGTTAATACC 300 AF AATTTTGTTACTAAAGGAATAGCAGAGGTACAAACTCCTTATTATTCAAGGGTTAATACC 300 ************************************************************ TIN12 TCTGTTGTTTCTGCTCCTGTTCTTTATAACGCAGGTAATATTTCTCCACTAATGCCGAAT 360 AF TCTGTTGTTTCTGCTCCTGTTCTTTATAACGCAGGTAATATTTCTCCACTAATGCCGAAT 360 ************************************************************ TIN12 GTTATGTATAAGATAACATCAAATTCATCAAACATTCTGCTTGGTCATTCTGCTGCTGAT 420 AF GTTATGTATAAGATAACATCAAATTCATCAAACATTCTGCTTGGTCATTCTGCTGCTGAT 420 ************************************************************ TIN12 GATTTCCGTTTTGGATTTCTCTTGGGAGCTCCATTAGCTATTTCAGCTACGGCTCTTAGA 480 AF GATTTCCGTTTTGGATTTCTCTTGGGAGCTCCATTAGCTATTTCAGCTACGGCTCTTAGA 480 ************************************************************ TIN12 GATAACTTTACGGGATCCTCTGCTACAGTTTCTCTTCCTACCTTCTCAAATTTTTATCTA 540 AF GATAACTTTACGGGATCCTCTGCTACAGTTTCTCTTCCTACCTTCTCAAATTTTTATCTA 540 ************************************************************ TIN12 TCTTCGACTTCAGAGTCCACTACTTAGAGGCTAGTGGTTGTTCGTACATTGGGTCAAGAC 600 AF TCTTCGACTTCAGAGTCCACTACTTAGAGGCTAGTGGTTGTTCGTACATTGGGTCAAGAC 600 ************************************************************ TIN12 TCAGTCTTGTTTTTCCGTATGTAAATATAAATATACATTCATTTATTGTAAATAATTATA 660 AF TCAGTCTTGTTTTTCCGTATGTAAATATAAATATACATTCATTTATTGTAAATAATTATA 660 ************************************************************ TIN12 TATATATGGTTTTGTTTGTTTGTAAATAATGTGCTTTTATATGTTTGTGTCTGTGTCTTT 720 AF TATATATAATTTTGTTTGTTTGTAAATAATGTGCTTTTATATGTTTGTGTCTGTGTCTTT 720 *******..*************************************************** TIN12 CAGGTTTCTTCTTGATTCTTCCTGAGGGTACTAATCGAATCATGTATTTTGTTTTATTAT 780 AF CAGGTTTCTTCTTGATTCTTCCTGAGGGTACTAATCGAATCATGTATTTTGTTTTATTAT 780 ************************************************************ TIN12 TATATACGTTTTTGTTCGCTTTGTCCGTTCAGTGGACCAAGTTTT 825 AF TATATACGTTTTTGTTCGCTTTGTCCGTTCAGTGGACCAAGTTTT 825 ********************************************* Alineamiento de aminoácidos (CLUSTAL 2.1) AF AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQ 60 TIN12 AADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQ 60 ************************************************************ AF GYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPN 120 TIN12 GYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPN 120 ************************************************************ AF VMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYL 180 TIN12 VMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYL 180 ************************************************************ AF SSTSESTT 188 TIN12 SSTSESTT 188 ******** 108

128 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES CAPÍTULO III REPLICACIÓN DE TRV EN CULTIVOS CELULARES 3.1- ANTECEDENTES Contar con líneas o cultivos celulares sensibles a la infección con TrV, podría traer grandes ventajas: permitirá aislar, caracterizar y estudiar en profundidad la biología del virus con el fin de obtener masa viral que podría ser utilizado como agente de control biológico. Si bien los ejemplos citados en la literatura hacen referencia al control biológico para plagas, no es arriesgado pensar en utilizar agentes de control biológico para eliminar vectores de enfermedades de gran prevalencia mundial y de alto impacto en la salud. Los virus son asociados con los insectos en un amplio rango de relaciones ecológicas: como patógenos, como vectores y como simbiontes (Christian y Scotti 2008). Existen al menos, catorce familias virales con representantes patógenos para invertebrados y algunas de estas familias poseen virus que ya han sido investigadas como agentes de control biológico para insectos. Dicistroviridae (Fig. 3a) es una de las familias propuestas para este fin (Erlandson M., 2008). Como describe Bonning y Miller, ocho miembros de la familia Dicistroviridae se reconocen patogénicos a insectos plaga de cultivos (CrPV, ALPV, RhPV, PSIV, HiPV, HoCV-1, SINV-1) o de importancia médica (TrV y SINV-1) (Bonning y Miller, 2010). Por lo tanto podrían ser utilizados como agentes de control biológico de acuerdo a su importancia. En Estados Unidos ante la invasión de la hormiga roja de fuego (Solenopsis invicta) y de la chicharrita de alas cristalinas (Homalodisca coagulata), el uso de Dicistrovirus como biopesticidas está siendo considerado, debido al alto costo como resultado del tratamiento de las victimas afectadas, la pérdida de animales y grandes pérdidas en los viñedos. 109

129 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Figura 3a: Árbol filogenético de los Dicistroviridae. En rojo está indicado el género Cripavirus. En negro el género, aún pendiente de aprobación, Aparavirus. Para cada uno de los virus están indicados sus hospederos en la naturaleza. Fuente: Hertz y Thompson (2011). De acuerdo a la bibliografía consultada, puede tomarse como modelo al virus de la parálisis del grillo (CrPV) que pertenece a la misma familia y género que TrV. El CrPV posee un amplio rango de huéspedes y replica fácilmente en distintas líneas celulares de insecto. Incluso este virus se ha adaptado muy fácilmente a crecer en cultivos en suspensión en gran escala, utilizando células de dípteros (DL2) (Scotti et al., 1996). Como señalan en sus resultados Christian y Scotti, el CrPV replica y causa efecto citopático en algunas líneas celulares derivadas de lepidópteros y dípteros (Moore et al., 1980). Generalmente la replicación viral coincidía con la aparición de efecto citopático (Masoumi et al., 2003). Masoumi describe además, la habilidad del CrPV para absorber y replicar en siete líneas celulares incubando células directamente con partículas virales purificadas y con transfección de ARN (Masoumi et al., 2003). El virus Drosophila C virus (DCV) replica fácilmente en muchas líneas 110

130 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES celulares obtenidas de Drosophila. Hasta el momento no se conocen otros Dicistrovirus que repliquen en líneas celulares (Boyapalle, 2007). Hasta el momento no ha sido posible establecer un cultivo celular continuo derivado de áfidos, algunos cultivos sólo fueron viables por unos pocos días. Boyapalle en su trabajo evaluó nueve líneas celulares derivadas de lepidóptera, díptera y hemíptera para diagnosticar la susceptibilidad de infección de otro Dicistrovirus, el Rhopalosiphum padi virus (RhPV). De esas nueve líneas celulares utilizadas, solo dos (de hemíptera), fueron permisivas por transfección del ARN de RhPV con aparición de efecto citopático (Boyapalle et al., 2007). Si bien, no se conocen líneas celulares susceptibles al TrV, se intentará su replicación en líneas de dípteros y lepidópteros. Se desconoce además, si el virus producirá efecto citopático (ECP) visible en las células MATERIALES Y MÉTODOS REPLICACIÓN DE TrV EN LÍNEAS CELULARES DE INSECTO Proceso de transfección El proceso de transfección implica la introducción de un ADN/ARN exógeno a una célula eucariota. Para la transfección del ARN viral se emplearon células de la línea celular de dípteros, Aedes albopictus (clon C6/36) y líneas celulares de lepidópteros: Spodoptera frugiperda (SF9, SF21) y HighFive. Las células SF9, SF21 (Spodoptera ATCC) y HighFive se obtuvieron de la Cátedra de Virología, congeladas en nitrógeno líquido. Del Banco Argentino de células (ABAC) se obtuvo la línea clon C6/36 (larva de Aedes albopictus ATCC). El RNA viral fue extraído de TrV purificado, por la metodología convencional de fenol/tiocianato de guanidina, ya expuesta anteriormente en el Capítulo 2 (Trizol Invitrogen). Partiendo de 500 µl de virus purificado con el agregado de 500 µl de Trizol y 220 µl de cloroformo. La precipitación se realizó con 750 µl de isopropanol y 650 µl de la fase acuosa durante toda la noche a -70 C. Se lavó 3 veces el pellet con 200 µl de etanol. Luego, se resuspendió el ARN en 20 µl de agua libre de nucleasas y se determinó la 111

131 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES concentración obtenida midiendo absorvancia a 260nm en un espectrofotómetro. Las células, en todos los casos, fueron cultivadas en frascos de cultivo celular de 25 cm³ (Greiner Bio-One BioScience, USA) y 75 cm³ (Greiner Bio- One BioScience, USA). Para evaluar la capacidad de infección de las células, cada línea celular fue sembrada en cuatro pocillos de una placa de 12 pocillos a una densidad distinta dependiendo del tipo celular y dejando pegar las células aproximadamente cuatro hs a TA. Las células SF9, SF21 y HighFive utilizan medio Grace y las células C6/36 crecen en medio esencial mínimo (MEM). En ambos casos se agrega 10% de SFB para crecimiento celular y 2% del mismo como medio de mantenimiento. Las células SF9 y SF21 fueron sembradas a una concentración de 1,5 x 10 5 cel/ml; las células C6/36 a 4x10 5 cel/ml y las HighFive al 6x10 4 cel/ml. Las células no adheridas y el medio fue removido y reemplazado con medio libre de suero y un pocillo fue tratado con cada mezcla. Los tratamientos fueron incubados toda la noche a 28 C. Una concentración de células de 2x10 6 cel/ml fue infectada con las distintas mezclas que fueron preparadas por triplicado, para las tres líneas celulares. De acuerdo a la bibliografía consultada, la transfección se realizó con lipofectina y entre 1 a 4 µg de ARN (Boyapalle et al., 2007; Masoumi et al., 2003). a) 2,5 µl RNA fresco µl TC100 b) 5 µl RNA fresco µl TC100 c) 40 µl lipofectina (Invitrogen) µl TC100 Todas las mezclas fueron incubadas a TA durante 45 min. Posteriormente, se mezclaron partes iguales de mezcla a + c y b + c y a cada tubo se agregó 800 µl de medio TC100. Luego se adicionó cada mezcla a cada pocillo con las monocapas de células durante 4 hs. Finalmente se agregó 1 ml de TC100 con 2% SFB a cada pocillo y se observó durante 7 días. Pasado ese tiempo se realizaron dos pasajes ciegos más en cada uno de los tipos celulares. 112

132 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Electroporación de ARN La electroporación es la incorporación de ADN/ARN a una célula mediante corriente eléctrica. Es un significativo aumento de la conductividad eléctrica y la permeabilidad de la membrana plasmática celular causado por un campo eléctrico aplicado externamente. Para realizar este método se partió de RNA purificado como fue descripto anteriormente. Partiendo de una concentración aproximada de 177 ng/ µl de ARN, se utilizaron 10 µl para cada ensayo. Se lavaron 2 veces en tubos falcon, 2 frascos de células SF9, HighFive y C6/36 con medio TC100. Luego cada tubo se resuspendió en 1 ml de medio y se cargaron las celdas de electroporación. Se adicionaron 10 µl de RNA a un tubo de los tres tipos celulares y el otro tubo servirá de control. La electroporación se realizó en hielo, a 310 V con un solo pulso (2.8 miliseg, 750V/cm, 10 uf) (Fig. 3b). Se dejaron 10 min en hielo. Luego se sembraron las células en placas de 6 pocillos. A las 4 horas de incubación a 28 C, se sacó el medio y se reemplazó por medio fresco TC100 con 2% SFB y se observó durante 7 días. Pasado ese tiempo se realizaron dos pasajes ciegos más en cada uno de los tipos celulares. Figura 3b: Electropador Cell-Porator utilizado para este procedimiento. 113

133 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Inoculación con tripsina A fin de facilitar la entrada del TrV a las células de insecto, se utilizó un método clásico de Virología, que consiste en la incubación a temperatura permisiva de virus y tripsina en el momento de la adsorción viral y luego, la adición de una cantidad de tripsina en el medio de cultivo. Este fenómeno se utiliza de rutina en muchos virus desnudos para facilitar la penetración viral (Hoshino et al., 2005). Se preparó una solución concentrada de 10 ug/ml de tripsina en solución fisiológica (10X). Se prepararon pocillos de células SF9, HighFive y C6/36 y alcanzada la monocapa celular a las 24 hs, se inocularon con la siguiente mezcla: 10 µl de solución de tripsina (1X) + 1 ml de virus purificado filtrado por 0,22 Se inocularon los pocillos respectivos dejando controles sin inocular, y luego de 1 h de incubación a 28 C, sin extraer el inóculo, se adicionó el medio de cultivo respectivo suplementado con 0,5 ug/ml de la solución de tripsina. Las células fueron observadas diariamente para la evaluación de ECP. Se realizaron dos pasajes más en cada tipo celular con los sobrenadantes de infección. Inoculación directa: virus purificado También se realizó la inoculación directa del virus. Para ello se filtró una cantidad de virus purificado diluido en un volúmen de PBS por 0,22 um. Se procedió de la siguiente manera: un frasco con monocapa completa de SF9, HighFive y C6/36 de 25 cm³ (Greiner Bio-One BioScience, USA) se sembró a una placa de 12 pocillos (Greiner Bio- One) y 24 horas después se prepararon las mezclas de inoculación: a) 10 µl de TrV purificado (aproximadamente 2,6mg/ml) + 90 µl de medio Grace b) 20 µl de TrV purificado + 80 µl de medio Grace La Pre- mezcla de incubó 15 min a Tº ambiente. Se cultivaron células SF9, Hi5 y C6/36 en una placa de 12 pocillos. Se removió el medio de cultivo y a cada uno se le agregaron las respectivas mezclas. Dos pocillos quedaron como 114

134 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES controles. La placa se incubó durante 1h a 27ºC y cada 15 min se movió suavemente la placa. Se adicionó Suero Fetal Bovino (SFB) al 2%. Luego de una incubación de 1 h a 27 C, el inóculo fue removido y reemplazado por 3 ml de medio TC con el agregado de 2% de SFB. Las células fueron incubadas a 27 C durante hs. Se procedió a la visualización de las mismas todos los días subsiguientes. Se realizaron pasajes, hasta 5 en algunos casos: el sobrenadante y las células fueron removidas y centrifugadas a rpm durante 10 min. Fueron nuevamente infectadas las células como se detalló anteriormente. De la misma manera se realizó electroporación de partículas virales purificadas con la metodología ya descripta OBTENCIÓN DE CULTIVO PRIMARIO DE T. INFESTANS LIBRE DE TrV En el caso de la replicación en cultivo primario, es la primera vez que se cita, por lo menos para el caso de TrV. Se detalla a continuación la metodología utilizada en cada caso para huevos o ninfas INSTALACIÓN Y MANTENIMIENTO DE COLONIAS DE T. INFESTANS EN EL LABORATORIO Para realizar el cultivo primario se utilizaron insectos de las colonias de T. infestans instaladas y mantenidas en el CEPAVE. Estas colonias fueron instaladas a partir de un pie de cría obtenido del Insectario del Servicio Nacional de Chagas localizado en Santa María del Valle de Punilla, provincia de Córdoba, en el año El mantenimiento general del Insectario fue llevado a cabo con la misma metodología descripta en el capítulo 2 (Marti, 2005). Las colonias se mantuvieron en insectario semejantes a los utilizados en los insectos de campo. Tanto machos como hembras de T. infestans se colocaron en recipientes plásticos de 12 cm de diámetro y 12 cm de altura cubiertos por una tela de nylon. En el interior de los recipientes se colocaron papeles plegados en posición vertical para permitirles a los insectos ascender hasta el borde del recipiente en el momento de la alimentación además de protegerse de la luz del ambiente entre los pliegues del papel. Se colocaron en recipientes separados por estadios: cerca de 100 individuos para las ninfas I y II, aproximadamente 40 ninfas III, IV y V y un número inferior a 20 en los 115

135 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES recipientes con adultos manteniendo la relación de sexo 1:1. La alimentación de los insectos y los parámetros del insectario fueron los mismos que se utilizaron para los insectos recolectados en el campo. El instrumental y los recipientes, tanto para el manejo de los insectos de la colonia como los recolectados en el campo, fueron mantenidos con lavados por inmersión en una solución de hipoclorito de sodio 2,5% durante 15 min, luego con 5 min de alcohol 96º, para finalizar con 5 min en agua destilada estéril. Cabe destacar que la única diferencia que existe con respecto a la colonia infectada con TrV, fue la no incorporación de ninfas periódicamente que si se le realiza a la colonia de TrV SUSTRATOS PARA LA REALIZACIÓN DE CULTIVO PRIMARIO: EMBRIONES Y ADULTOS Embriones Para este sustrato se utilizaron distintas metodologías. Para todos los casos la temperatura de incubación fue de 28 C y se emplearon placas de plástico estéril. Todos los ensayos se observaron diariamente hasta verificar la formación de clones celulares. Se utilizó el método descripto por Bell-Sakyi y colaboradores (2007). Se alimentaron adultos de la colonia del insectario y se tomaron las hembras. Estas se lavaron 5 min en tiomersal y 20% de etanol. Luego 5 min en cloruro de benzalconio y 1 min en etanol 70%. Se realizaron dos lavados en agua estéril y se dejó secar. Se incubaron en placa de petri hasta su oviposición. Luego de 7-10 días de la oviposición, se lavaron los huevos durante 2 min con etanol 70% y se enjuagaron dos veces con agua destilada estéril y una vez con medio de cultivo. Utilizando un mortero se obtuvieron las cáscaras de los huevos y se las sumergió con HLT. La solución fue filtrada con malla estéril (70 % etanol) y se retiraron cuidadosamente las cascaras. Sin tripsina En una cápsula de petri se colocaron los huevos con PBS para su hidratación y lavado. Se seleccionaron los huevos con un espejo con aumento, debido al tamaño de los mismos, y con una pinza previamente esterilizada se 116

136 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES transfirieron a otra cápsula. Se procedió a abrirlos cuidadosamente, con la ayuda de la lupa y la pinza y se retiró cuidadosamente el embrión. Se traspasó a un mortero con medio de cultivo Grace, congregando en pequeños grupos de 10, 15 y 20 embriones. Se procedió a disgregar las células cuidadosamente con pipeteo. Se sembró una placa de 12 pocillos y se rotuló debidamente. Con el mismo macerado se sembraron distintas cantidades en los pocillos: 100, 200, 400 y 500 µl, a los que se agregaron cantidades suficientes de medio Grace con 10% SFB para permitir el crecimiento de las células (Fig. 3c). Con tripsina En este método se procedió de manera similar a lo anterior, pero realizando la dispersión de las células en agitación con una solución de tripsina, durante 15 min. Luego, se procedió a centrifugar a 1500 rpm por 5 min, para luego resuspender en medio Grace con 10% SFB y sembrar en distintos volúmenes como fue indicado en el apartado anterior. En este caso se realizaron algunas modificaciones como ser, el filtrado por malla metálica estéril y la trituración con tijeras. Explantos En este caso se colocaron en pocillos de placas la cantidad de 10, 15 o 20 embriones con medio de crecimiento, a fin de obtener explantos celulares. 117

137 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Figura 3c: Preparación de los embriones de triatominos para realizar cultivo primario. Adultos Para los puntos subsiguientes la metodología fue básicamente la misma. Los triatominos que se utilizaron fueron adultos, 5 hembras y 5 machos, privados de ingesta durante 20 días. Al momento de retirar gónadas (testículos y ovarios), buche e intestino, se colocaron en cápsulas de petri con PBS. Se cortaron los órganos y se mezclaron con la ayuda de una pipeta. Se colocó tripsina como agente dispersante: 1,5 o 3 ml dependiendo el tamaño. Se colocaron perlas de vidrio e imán en un enlermeyer y se colocó en agitación 20 min. Se centrifugó y se descarto la tripsina. Se procedió a sembrar, colocando previamente medio de cultivo con 10% SFB y por último 20 µl de antibiótico (ATB, Penicilina). 118

138 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES INOCULACIÓN DE HUEVOS EMBRIONADOS DE AVES La técnica de inoculación en huevos embrionados es utilizada para el aislamiento de varios virus, entre ellos el virus influenza. Para ser inoculados debe reunir ciertas condiciones, como ser la edad (tiempo de incubación) para que el embrión, las cavidades extraembrionarias y membranas adquieran el tamaño necesario de acuerdo con la vía de inoculación elegida, y además provenir de animales con buenas condiciones sanitarias. El éxito de la infección puede manifestarse como muerte del embrión, alteraciones macro y microscópicas, cuerpos de inclusión, hemorragias, retraso en el crecimiento, etc. No hay antecedentes sobre el tema para el caso de TrV. Por lo cual se tomo al virus de la aftosa como ejemplo para realizar la técnica, ya que en un principio TrV estuvo ubicado taxonómicamente dentro de los Picornaviridae (la misma familia a la que pertenece el virus aftosa). Se seleccionó la cavidad alantaoidea para realizar la inoculación del virus. Se inocularon 0,2 ml del virus purificado a nueve huevos y 0,2 ml de PBS estéril a otros tres huevos, utilizados como control negativo. Con esmalte se selló el punto de inoculación y la cámara de aire. Se lo dejó incubar a 3 temperaturas: 28, 32 y 37 C cada grupo (3 más 1 control) durante 96 hs. Luego, se cosechó el líquido alantoideo, y se traspasó a un tubo falcon para centrifugarlo. Se realizó la técnica de hemaglutinación (HA) para verificar la presencia y título del virus TÉCNICAS DE CONFIRMACIÓN Para todos los métodos y ensayos descriptos en este apartado, se utilizaron técnicas de SDS-PAGE, Western Blot (WB), Inmunofluorescencia indirecta (IFI) y RT-PCR para confirmar la presencia del TrV en las células. Para evaluar el líquido alantoideo se utilizó la técnica de hemaglutinación (HA). SDS-PAGE Las células fueron removidas y centrifugadas a 5000 rpm durante 10 min. El sobrenadante fue recolectado y el pellet fue lavado en PBS (PBS: 50nM Fosfato de Potasio; 150 nm NaCl; ph 7.2) para eliminar los restos de medio y 119

139 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES resuspendido en 200 a 300 µl del mismo buffer. Luego 30 µl de muestra fueron combinados con partes iguales de 2X buffer de muestra para SDS- PAGE. Posteriormente las muestras fueron sometidas a 90 C en bloque térmico durante 5 min. Para la técnica de SDS-PAGE fue utilizada la cuba Bio- Rad Mini- PROTEAN Tetra Cell (Bio- Rad, USA). Los geles de poliacrilamida fueron preparados al 12,5%. El gel de siembra fue preparado al 5%. Se sembraron 20 µl de muestra y se utilizó el marcador de peso molecular Page Ruler Prestained Protein Ladder (Fermentas). La separación de las proteínas se logró mediante una corrida electroforética, para dos minigeles, a 80 V durante 4 horas, utilizando buffer Tris glicina 1X. Los geles fueron teñidos con azul brillante de Coomassie al 0,1% y desteñidos con una solución decolorante en agitación durante 12 h. WESTERN BLOT (WB) La técnica de Western Blot consiste en la transferencia de las muestras proteicas separadas electroforéticamente en gel a una membrana soporte en donde se realiza la inmunodetección de estas proteínas con anticuerpos específicos hacia las mismas. Para realizar la transferencia de proteínas se realizaron geles de SDS-PAGE como fue explicado en el punto anterior sin teñir en Coomassie. Luego de la corrida electroforética, se equilibró el gel en buffer de transferencia, a fin de facilitar la remoción de sales y detergentes del buffer de corrida. Se cortaron membranas de nitrocelulosa (Sigma) de 0,45 µm y papel de filtro del tamaño del gel las que también fueron humedecidas en buffer de transferencia para asegurar la correcta adhesión de las moléculas al soporte. Se armo el sándwich de transferencia evitando la formación de burbujas entre los distintos componentes. La electrotransferencia se realizó en sistema semiseco (BioRad) a 15 V durante 30 min. Finalizado el tiempo de transferencia se retiró la membrana y se incubó toda la noche a 4 ºC en solución de leche descremada para bloquear los sitios libres de la membrana donde no hubiera proteína unida. Luego del bloqueo, la membrana fue lavada 3 veces durante 5 min con PBS-Tween 20 0,1% para eliminar los restos de solución de bloqueo. Para la detección de las proteínas, se utilizaron el anticuerpo primario (suero de conejo anti-trv diluido 1/40) y secundario (anti-conejo conjugado con peroxidasa diluido 1/400 Sigma) (Marti et al., 120

140 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES 2008). La membrana se incubó entre 1-3 horas a TA con cada uno de los anticuerpos. Entre cada una de las incubaciones se realizaron 3 lavados de 5 min con PBS-Tween 20 0,1%. Para el revelado de la reacción se empleó Diaminobenzidina (DAB) (Sigma) y agua oxigenada como sustrato de la enzima peroxidasa. En algunos revelados se reemplazo la DAB por 3,3, 3,5 tetrametilbenzidina (TMB) (Promega). Las soluciones utilizadas en la técnica de Western Blot se detallan a continuación: a) Solución de Bloqueo: 5% de leche en polvo (Gibco) en PBS-Tween 20 0,1%. b) Solución diluyente: 3% de leche en polvo (Gibco) en PBS-Tween 20 0,1%. c) Solución de lavado: PBS Tween 20 0,1%. d) Solución de revelado: 30mg de DAB y disolver en 100ml de PBS. Agregar 30 µl de H2O2 30 Vol como catalizador. Frenar la reacción de revelado con agua corriente. Técnica de inmunufluorescencia indirecta (IFI) La técnica de inmunofluorescencia indirecta es ampliamente usada en el diagnóstico virológico debido a su alta especificidad. Es muy útil para el diagnóstico e identificación de un virus que fue aislado como así también para diagnóstico. Esta técnica requiere de anticuerpos (Ac) purificados, un Ac primario y uno conjugado con fluoresceína (fluorocromo con la propiedad de excitarse con los rayos UV y emitir, de esa manera, una luz verde brillante) o Ac secundario anti-especie. Estos generalmente son comerciales. La técnica consiste básicamente en colocar las células infectadas con el virus, en un portaobjetos o celdas de cultivo estériles (BD Falcon). Monocapas confluyentes de células SF9, HighFive y C6/36 crecidas en cámaras de cultivo, se inocularon con los sobrenadantes de las experiencias anteriores, aproximadamente 100 µl (cuartos o quintos pasajes de transfección, electroporación o virus purificados). Los portaobjetos se incubaron a 27ºC durante 1 hs y luego se agregó medio TC100 con 2% SFB (200 ul). Luego de 72 hs, se recolectó el sobrenadante y las células se fijaron con acetona a -20ºC durante toda la noche. Los portaobjetos se lavaron tres veces con solución 121

141 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES fisiológica y se los incubó a 37ºC durante 45 min con el suero primario de conejo anti-trv en distintas diluciones (1/20, 1/40, 1/80). Luego de 3 lavados suaves con SF, se adicionó el suero secundario anti-conejo conjugado con ITCF diluido en SF 1/100 (parte superior) y 1/200 (parte inferior de la cámara) a 37ºC durante 45 min en cámara húmeda. Finalmente, se realizaron tres lavados de cinco min con solución fisiológica. Si existió unión Antígeno- Anticuerpo (Ag-Ac), el Ac quedará unido y no será arrastrado. Luego se dejó suavemente secar y se procedió al montaje (50% glicerina + 50% de SF). La visualización de las células infectadas se realizó en un microscopio de epifluorescencia Olympus System microscope Model BHS: si las células estuviesen infectadas con el virus se visualizará una reacción verde brillante característica. Detección directa por RT-PCR Para la verificación de infección en este caso se modificaron los moldes, del resultado del cultivo de células, ya sea pellet o sobrenadante. La extracción de ARN se realizó con 50 µl de pellet y 300 µl de sobrenadante de acuerdo al método indicado en el Capítulo 2. Microscopio electrónico de transmisión (MET) El uso de la microscopía electrónica ha permitido importantes avances en el estudio de las estructuras celulares. Los microscopios electrónicos modernos poseen una resolución del orden de los 0,2 nm. El microscopio electrónico de barrido (MEB) revela detalles tanto de superficie como intracelular; en el microscopio electrónico de transmisión (MET), un haz homogéneo de electrones pasa dentro de una columna con alto vacío, a alta velocidad, a través de una muestra lo suficientemente delgada como para transmitir no menos del 50% de los electrones que inciden sobre ella. El microscopio utilizado en este trabajo es de transmisión, como fue indicado en el Capítulo 2. Técnica para células Para la técnica de microscopía electrónica, células supuestamente infectadas con el virus fueron lavadas tres veces con PBS estéril y 122

142 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES centrifugadas a 1000 rpm durante 10 min y fijadas en glutaraldehido. Luego, el material se seccionó en un ultramicrótomo LKB Ultrotome III automático, con un espesor de 100 nm, colocándolos en grillas. Los cortes fueron contrastados en una gota de acetato de uranilo acuoso durante cinco min. Se lavaron tres veces en agua desionizada e inmediatamente se sumergieron en una gota de citrato de plomo durante cinco min. Las grillas se lavaron con agua desionizada 3 veces y se dejaron secar al aire antes de ser observadas. Tinción negativa Una gota de sobrenadante supuestamente infectado con el virus fue colocada en una grilla con membrana de colodión y se la dejó absorber durante 7 min, retirando el excedente. A continuación, una gota de ácido fosfotungstico fue colocada sobre la grilla e incubada durante 40 seg. Finalmente, la grilla fue secada unos min y observada en el microscopio electrónico. Técnica de hemaglutinación (HA) El principio de esta técnica consiste en demostrar la presencia de hemaglutininas virales. Este fenómeno ocurre en el líquido sobrenadante del cultivo. Este líquido (rico en virus), se enfrenta con una suspensión de glóbulos rojos. Si la reacción es positiva, los glóbulos rojos forman una malla fina, que se deposita lentamente en el fondo del tubo y se visualiza como un halo grande. Por el contrario, si es negativa, decantan al fondo del tubo formando un botón. El uso de esta técnica sólo permite arribar a un diagnóstico presuntivo. En este caso, se escogió un vial de virus purificado y una solución de glóbulos rojos de pollo. Asimismo se evaluaron los líquidos alantoideos cosechados y los sobrenadantes de infección. Se extrajeron 5 ml de sangre de pollo en solución de Alsevers (0,055% de Ac. Cítrico; 0,8% de Citrato de sodio; 2,05% de Glucosa; 0,42% de Cloruro de sodio y agua tridestilada). Se centrifugó la mezcla eliminando el plasma sanguíneo, y utilizando únicamente los glóbulos rojos, para ello se centrifugó a 2000 rpm durante cinco min. Se repitió el procedimiento tres veces utilizando el paquete de glóbulos rojos y PBS. Se descartó el sobrenadante y se colocó nuevamente PBS, mezclando suavemente (250 µl de paquete globular en 50 m de PBS - 123

143 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES 0,5%-). Se cargó la placa de 96 pocillos (fondo V ), con 50 µl de PBS desde la segunda columna y se colocó en la primera, 100 µl del virus purificado o líquido alantoideo o sobrenadante de infección. Con pipeta multicanal se realizaron diluciones base 2 hasta la columna 11. La columna 12 contiene sólo 50 µl de PBS. Por último se agregaron 50 µl de la solución de glóbulos rojos lavados y se dejó a TA 1 h en incubación para su lectura RESULTADOS REPLICACIÓN DE TrV EN CÉLULAS DE INSECTO Y CULTIVO PRIMARIO La inoculación del TrV en cultivos celulares de insecto, ya sea como partículas purificadas completas como con ARN purificado evidenció en algunos casos probables signos de infección o ECP visible en las primeras hs. Luego de los sucesivos pasajes, este efecto desaparecía. Estos experimentos fueron realizados en 3 oportunidades en el caso de la electroporación de ARN y en dos oportunidades mediante adición de lipofectina; 2 en el caso de inoculación directa de virus purificado y 2 por electroporación de partículas virales (Fig. 3d). 124

144 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Figura 3d: A la izquierda, células H5 infectadas con TrV (con lipofectina). En el centro células H5 infectadas con TrV. A la derecha células SF21 infectadas con TrV (con lipofectina). Debajo de cada una su control de células correspondiente. No fue posible obtener un clon celular a partir del ensayo partiendo de tejidos adultos o embrionarios de vinchucas sanas. A pesar de decontaminar las superficies tanto de adultos como de embriones, los mismos se contaminaron antes que pudieran anclarse las células al soporte. En algunos casos, los pocillos no se contaminaron en forma inmediata, pero al cabo de 5-6 días, si lo hicieron INOCULACIÓN DE HUEVOS EMBRIONADOS En cuanto a la presencia de virus en líquido alantoideo por HA, en ningún caso obtuvimos resultado positivo, ni tampoco utilizando sobrenadantes supuestamente infectados (Fig. 3e). Sin embargo el virus TrV purificado utilizado como control, aglutinó los glóbulos rojos de pollo (Fig. 3e, abajo). 125

145 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES C GR Figura 3e: Figura representativa de la técnica HA. 1: Líquido alantoideo A; 2: líquido alantoideo B; 3: sobrenadante de infección H5 (lipofectina). C: control líquido alantoideo sin infectar. GR: solución de glóbulos rojos lavados. En la figura de abajo: técnica HA mostrando a TrV (virus purificado) aglutinando glóbulos rojos TÉCNICAS DE CONFIRMACIÓN En las pruebas complementarias de SDS-PAGE, WB, IFI, RT-PCR y ME no se obtuvieron resultados satisfactorios. A continuación se detallan individualmente cada una. Para la técnica de SDS-PAGE se pudo evidenciar un resultado positivo luego de los primeros pasajes, mostrando con el pasar de los días un resultado negativo. En la figura pueden visualizarse las proteínas del virus (Fig. 3f). 126

146 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Figura 3f: A. Calle 1: Page Ruler Prestained Protein Ladder. Calle 2: Células SF9 sin infectar. Calle 3: Células SF9 infectadas. Calle 4: Control TrV B. Calle 1: Células H5 infectadas. Calle 2 y 3: Control TrV. Calle 4: Marcador Low Biorad. En cuanto a la técnica de W. BLOTT solo se evidenciaron resultados positivos luego del primer pasaje de células, como en el caso anterior (Fig. 3g). Figura 3g: Calle 1: Control de virus. Calle 2: Page Ruler Prestained Protein Ladder. Calle 3: SF9 (lipofectina). Calle 4: H5 (lipofectina). Calle 5: C6/36 (electroporación). Calle 6: SF9 (electroporación). Calles 7, 8 y 9: control de células SF9, H5 y C6/36 respectivamente. 127

147 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES La técnica de Inmunofluorescencia Indirecta realizada en células H5 infectadas con TrV mostró una fluorescencia inespecífica ya que en el control pueden evidenciarse las células con el color verde fluorescente característico (Fig. 3h). Figura 3h: Células HighFive infectadas (método lipofectina); al lado control de células. La RT-PCR muestra resultados positivos solo luego del primer pasaje de células, como ocurre con el resto de las técnicas confirmatorias (Fig. 3i). 128

148 CAPÍTULO III: REPLICACIÓN DE TrV EN CULTIVOS CELULARES Figura 3i: L: marcador de peso molecular (100 bp). Calles 1-3 electroporación: 1:C6/36; 2:H5; 3:SF9. Calles 4-6 lipofectina: 4:C6/36; 5:H5; 6:SF9. Calles 7-9 controles de células: 7:C6/36; 8:H5; 9:FF9. Calle 10: control positivo. Calle 11: control negativo del virus. En cuanto a la Microscopia Electrónica no se han observado resultados positivos como se muestra en la siguiente figura, resultado de la electroporación de las partículas completas del virus. Se optó por mostrar en la figura las células HighFive ya que es en estas células donde puede evidenciarse mucho más el posible efecto citopático evidenciado éste, por un cambio en la morfología de las células (Fig. 3j). Figura 3j: Células H5 control y supuestamente infectadas con TrV (10000X). 129

The Gifted HDTV 720p AC3 5.1 | What Do You Think Of Whe | Prezzo: Più basso